Project name: 1e86976f866a4b5

Status: done

Started: 2026-06-25 11:00:56
Settings
Chain sequence(s) A: MSHHHHHHSGMEWMKEKVENYEYKGENKEIHEKIREIMKEILRIHEELIPRLEKLSKESGVPFEEIADPVHGIFSSGFQIFMHAVHFESESFDKEEAIEAVEFTLEVMKELASKEYKSAEELIEEAVKLYKETDKKFEELWDKAEPEIKAKENS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:09:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:09:45)
Show buried residues

Minimal score value
-4.2897
Maximal score value
0.7783
Average score
-1.7321
Total score value
-266.7441

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.5304
2 S A -0.5575
3 H A -1.4405
4 H A -1.5917
5 H A -1.8998
6 H A -2.3671
7 H A -2.1587
8 H A -1.9541
9 S A -1.5812
10 G A -1.4193
11 M A 0.0000
12 E A -2.6840
13 W A -1.3505
14 M A 0.0000
15 K A -3.0647
16 E A -3.3593
17 K A -2.5830
18 V A 0.0000
19 E A -3.7593
20 N A -3.1659
21 Y A -2.2478
22 E A -2.8360
23 Y A 0.0000
24 K A -2.8367
25 G A -2.4388
26 E A -2.9043
27 N A -2.3925
28 K A -3.4335
29 E A -3.2081
30 I A -2.1103
31 H A 0.0000
32 E A -2.6141
33 K A -2.8580
34 I A 0.0000
35 R A 0.0000
36 E A -2.9594
37 I A 0.0000
38 M A 0.0000
39 K A -2.3746
40 E A -2.0464
41 I A 0.0000
42 L A 0.0000
43 R A -3.0921
44 I A 0.0000
45 H A 0.0000
46 E A -3.4720
47 E A -3.1467
48 L A 0.0000
49 I A 0.0000
50 P A -1.6159
51 R A -2.0477
52 L A 0.0000
53 E A -2.4080
54 K A -3.1744
55 L A -2.7282
56 S A -2.8924
57 K A -3.4626
58 E A -3.4618
59 S A -2.3516
60 G A -1.7096
61 V A -1.6667
62 P A -1.6489
63 F A 0.0000
64 E A -3.1179
65 E A -3.0699
66 I A 0.0000
67 A A 0.0000
68 D A -2.7900
69 P A -1.6720
70 V A 0.0000
71 H A -1.1851
72 G A -0.7879
73 I A 0.0000
74 F A 0.0000
75 S A -0.3625
76 S A -0.6527
77 G A 0.0000
78 F A 0.0000
79 Q A -0.6758
80 I A 0.0000
81 F A 0.0000
82 M A -0.2287
83 H A -0.1212
84 A A 0.0000
85 V A 0.7783
86 H A -0.3071
87 F A 0.0000
88 E A -1.6265
89 S A 0.0000
90 E A -2.5027
91 S A -2.1608
92 F A 0.0000
93 D A -2.6639
94 K A -2.2706
95 E A -2.8479
96 E A -2.8760
97 A A 0.0000
98 I A -2.1274
99 E A -2.9437
100 A A 0.0000
101 V A 0.0000
102 E A -2.1954
103 F A -1.7473
104 T A 0.0000
105 L A -1.9245
106 E A -2.8277
107 V A 0.0000
108 M A 0.0000
109 K A -2.8721
110 E A -3.1439
111 L A 0.0000
112 A A -2.1442
113 S A -1.9374
114 K A -2.4988
115 E A -2.7578
116 Y A -2.4566
117 K A -2.9109
118 S A -2.5572
119 A A 0.0000
120 E A -3.3398
121 E A -3.4157
122 L A 0.0000
123 I A -2.4267
124 E A -3.0024
125 E A -2.3551
126 A A 0.0000
127 V A -1.4889
128 K A -2.7132
129 L A -2.0439
130 Y A -1.7400
131 K A -3.3722
132 E A -3.5106
133 T A 0.0000
134 D A -3.3890
135 K A -4.2897
136 K A -3.6918
137 F A 0.0000
138 E A -4.2437
139 E A -4.2895
140 L A 0.0000
141 W A -2.9859
142 D A -3.8155
143 K A -3.4746
144 A A 0.0000
145 E A -2.7008
146 P A -2.1585
147 E A -2.6640
148 I A -2.5914
149 K A -3.4436
150 A A -2.7030
151 K A -3.3323
152 E A -3.6859
153 N A -3.0999
154 S A -2.0454
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018