Project name: 1eec448655c9004

Chain sequence(s)	A: EVQLVESGGGLVQPGGSLRLSCAASGGVNSDDFSLIPMGWFRQAPGKGRELVAAIGGDDAGATFLGHTIAAGATYYPDSVEGRFTISRDNAKRMVYLQMNSLRAEDTAVYYCAAKVGRKWYWGQGTQVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:55)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:56)

• Minimal score value: -2.9367
• Maximal score value: 1.0144
• Average score: -0.8719
• Total score value: -115.0906

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-2.1739
2	V	A	-1.2244
3	Q	A	-1.4734
4	L	A	0.0000
5	V	A	0.1821
6	E	A	-0.2616
7	S	A	-0.8206
8	G	A	-1.0450
9	G	A	-0.8159
10	G	A	-0.0573
11	L	A	0.9935
12	V	A	-0.1066
13	Q	A	-1.4606
14	P	A	-1.8536
15	G	A	-1.5887
16	G	A	-1.0751
17	S	A	-1.3125
18	L	A	-0.8903
19	R	A	-2.1224
20	L	A	0.0000
21	S	A	-0.5277
22	C	A	0.0000
23	A	A	-0.4031
24	A	A	0.0000
25	S	A	-1.2256
26	G	A	-1.5066
27	G	A	-1.5837
28	V	A	0.0000
29	N	A	-2.7642
30	S	A	-2.6690
31	D	A	-2.8843
32	D	A	-2.5717
33	F	A	0.0000
34	S	A	-2.0253
35	L	A	-1.1496
36	I	A	0.0000
37	P	A	0.0000
38	M	A	0.0000
39	G	A	0.0000
40	W	A	0.0000
41	F	A	0.0000
42	R	A	0.0000
43	Q	A	-1.4023
44	A	A	-1.5553
45	P	A	-1.0828
46	G	A	-1.6307
47	K	A	-2.5440
48	G	A	-1.9688
49	R	A	-1.4259
50	E	A	-0.8949
51	L	A	0.0000
52	V	A	0.0000
53	A	A	0.0000
54	A	A	0.0000
55	I	A	-0.1222
56	G	A	0.0000
57	G	A	0.0000
58	D	A	-2.5965
59	D	A	-2.5014
60	A	A	-1.3262
61	G	A	-0.8321
62	A	A	0.0000
63	T	A	-0.0816
64	F	A	0.0000
65	L	A	1.0144
66	G	A	0.0304
67	H	A	-0.1912
68	T	A	-0.1853
69	I	A	0.0000
70	A	A	-0.5804
71	A	A	-1.2956
72	G	A	-1.3596
73	A	A	-0.3636
74	T	A	0.1117
75	Y	A	-0.0639
76	Y	A	-0.8377
77	P	A	-1.4528
78	D	A	-2.5812
79	S	A	-1.8508
80	V	A	0.0000
81	E	A	-2.7482
82	G	A	-1.8480
83	R	A	-1.6027
84	F	A	0.0000
85	T	A	-0.8080
86	I	A	0.0000
87	S	A	-0.4485
88	R	A	-1.1332
89	D	A	-1.7600
90	N	A	-2.8082
91	A	A	-2.1299
92	K	A	-2.6030
93	R	A	-2.5352
94	M	A	-1.1029
95	V	A	0.0000
96	Y	A	-0.5988
97	L	A	0.0000
98	Q	A	-1.2473
99	M	A	0.0000
100	N	A	-1.5144
101	S	A	-1.4428
102	L	A	0.0000
103	R	A	-2.9367
104	A	A	-2.0325
105	E	A	-2.4665
106	D	A	0.0000
107	T	A	-0.9607
108	A	A	0.0000
109	V	A	-0.3985
110	Y	A	0.0000
111	Y	A	-0.1610
112	C	A	0.0000
113	A	A	0.0000
114	A	A	0.0000
115	K	A	-0.8841
116	V	A	-0.8632
117	G	A	-1.5759
118	R	A	-2.7486
119	K	A	-2.4120
120	W	A	-0.6298
121	Y	A	-0.1874
122	W	A	0.2729
123	G	A	-0.3189
124	Q	A	-1.0114
125	G	A	0.0000
126	T	A	-0.7972
127	Q	A	-0.9999
128	V	A	0.0000
129	T	A	-0.3614
130	V	A	0.0000
131	S	A	-0.8243
132	S	A	-0.4750