Project name: query_structure

Status: done

Started: 2026-03-16 23:05:47
Settings
Chain sequence(s) A: ECGKFMWKCKNSNDCCKDLVCSSRWKWCVLASPF
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:46)
Show buried residues

Minimal score value
-2.7282
Maximal score value
1.5991
Average score
-0.6582
Total score value
-22.3787

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -2.1066
2 C A -1.0875
3 G A 0.0000
4 K A -0.7621
5 F A 1.3060
6 M A 1.2398
7 W A 0.3269
8 K A -1.7672
9 C A -1.8721
10 K A -2.7282
11 N A -2.5064
12 S A -1.8954
13 N A -2.4344
14 D A -2.1804
15 C A 0.0000
16 C A -1.2195
17 K A -2.2245
18 D A -1.1325
19 L A 0.2198
20 V A 0.4191
21 C A -0.5556
22 S A -0.8981
23 S A -1.8760
24 R A -1.9726
25 W A -0.2920
26 K A -1.7265
27 W A -0.5564
28 C A 0.0000
29 V A 1.2200
30 L A 1.5991
31 A A 0.6759
32 S A 0.2559
33 P A 0.6128
34 F A 1.5400
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018