Project name: IL6_Nanobody14

Chain sequence(s)	A: QVQLVESGGGLVQPGGSLRLSCAASGSTKPQPGQGGWFRQAPGQGLEAVAVEGPTPEDRAIAGTGPPRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAWHPGPGITAAELPEEATWGQGTLVTVS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:01)

• Minimal score value: -3.475
• Maximal score value: 1.6863
• Average score: -0.7015
• Total score value: -87.6912

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	A	-1.4559
2	V	A	-1.0063
3	Q	A	-1.2179
4	L	A	0.0000
5	V	A	0.9227
6	E	A	0.0000
7	S	A	-0.2240
8	G	A	-0.6740
9	G	A	0.0756
10	G	A	0.8089
11	L	A	1.3934
12	V	A	-0.0652
13	Q	A	-1.3607
14	P	A	-1.7937
15	G	A	-1.5753
16	G	A	-1.2247
17	S	A	-1.4274
18	L	A	-1.1659
19	R	A	-2.3578
20	L	A	0.0000
21	S	A	-0.5360
22	C	A	0.0000
23	A	A	-0.1213
24	A	A	-0.4655
25	S	A	-0.8366
26	G	A	-1.0625
27	S	A	-1.1354
28	T	A	-1.2048
29	K	A	-2.2825
30	P	A	-2.0705
31	Q	A	-2.2906
32	P	A	-1.3292
33	G	A	-1.0743
34	Q	A	0.0000
35	G	A	0.0000
36	G	A	0.0000
37	W	A	0.0000
38	F	A	0.0000
39	R	A	0.0000
40	Q	A	-0.9667
41	A	A	-1.1421
42	P	A	-1.1872
43	G	A	-1.3512
44	Q	A	-1.9694
45	G	A	-1.4722
46	L	A	-0.8714
47	E	A	-1.6505
48	A	A	-0.8577
49	V	A	0.0000
50	A	A	0.0000
51	V	A	0.0000
52	E	A	0.0000
53	G	A	0.0000
54	P	A	0.0000
55	T	A	-1.3496
56	P	A	-1.9593
57	E	A	-3.4750
58	D	A	-3.3732
59	R	A	-2.8350
60	A	A	-0.7797
61	I	A	-0.0283
62	A	A	-0.1572
63	G	A	-0.3966
64	T	A	-0.5179
65	G	A	0.0000
66	P	A	-0.2845
67	P	A	-0.5116
68	R	A	-0.7816
69	F	A	0.0000
70	T	A	-0.9414
71	I	A	0.0000
72	S	A	-1.0003
73	R	A	-1.3066
74	D	A	-1.6994
75	N	A	-2.1469
76	S	A	-1.7006
77	K	A	-2.2859
78	N	A	-1.9001
79	T	A	0.0000
80	L	A	0.0000
81	Y	A	-0.7874
82	L	A	0.0000
83	Q	A	-1.8544
84	M	A	0.0000
85	N	A	-1.5504
86	S	A	-1.3721
87	L	A	0.0000
88	R	A	-2.9310
89	A	A	-1.9986
90	E	A	-2.4569
91	D	A	0.0000
92	T	A	-0.5507
93	A	A	0.0000
94	V	A	0.7844
95	Y	A	0.0000
96	Y	A	0.2689
97	C	A	0.0000
98	A	A	0.0000
99	W	A	0.0000
100	H	A	-0.7360
101	P	A	-1.0202
102	G	A	-0.7116
103	P	A	-0.7199
104	G	A	-0.2469
105	I	A	1.2827
106	T	A	0.1767
107	A	A	-0.2299
108	A	A	0.0000
109	E	A	-2.0815
110	L	A	-0.6914
111	P	A	-1.0715
112	E	A	-1.9559
113	E	A	0.0000
114	A	A	-0.2293
115	T	A	-0.4398
116	W	A	0.1663
117	G	A	-0.1834
118	Q	A	-0.9053
119	G	A	0.0628
120	T	A	0.5987
121	L	A	1.6863
122	V	A	0.0000
123	T	A	0.3161
124	V	A	0.0000
125	S	A	-0.6535