Project name: 1fdce0426dcfae4

Chain sequence(s)	A: THQVCPDGFDWGYGCAAGSSRFCTRHDWCCYDERADSHTYGFCTGNRVTN
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:28)

• Minimal score value: -2.3967
• Maximal score value: 1.4282
• Average score: -0.6049
• Total score value: -30.2442

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	T	A	-0.8741
2	H	A	-1.7553
3	Q	A	-1.7815
4	V	A	-0.4984
5	C	A	0.0000
6	P	A	-1.3120
7	D	A	-2.3627
8	G	A	-1.6642
9	F	A	-1.1830
10	D	A	-0.8663
11	W	A	0.8847
12	G	A	0.9671
13	Y	A	1.4282
14	G	A	0.0000
15	C	A	0.0000
16	A	A	-0.5945
17	A	A	-0.6767
18	G	A	-0.5283
19	S	A	-0.2522
20	S	A	-0.5933
21	R	A	-1.0453
22	F	A	0.7313
23	C	A	-0.0331
24	T	A	-0.6185
25	R	A	-2.1289
26	H	A	-1.2865
27	D	A	-0.6169
28	W	A	1.3212
29	C	A	0.0000
30	C	A	0.0000
31	Y	A	0.0850
32	D	A	0.0000
33	E	A	-1.6978
34	R	A	-2.3967
35	A	A	-1.5570
36	D	A	-2.3017
37	S	A	-1.5326
38	H	A	-1.2370
39	T	A	-0.4042
40	Y	A	0.0990
41	G	A	0.2830
42	F	A	0.5015
43	C	A	0.4249
44	T	A	-0.2885
45	G	A	-1.0744
46	N	A	-1.1383
47	R	A	-1.2227
48	V	A	0.4607
49	T	A	-0.5329
50	N	A	-1.3753