Project name: Mb5-11_FFVFVR

Status: done

Started: 2026-07-06 06:29:01
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQFSWDAFHRYHNGFTHPVRYYRFTYGETGGNSPVQEFTVPGSKSTATVSGLKPGVDYTFTVYAVTWYPRYGYGESGPVSRNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:59)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:00)
Show buried residues

Minimal score value
-2.8451
Maximal score value
1.3939
Average score
-0.817
Total score value
-89.0499

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.3054
2 Q A -1.0022
3 A A -1.1662
4 N A -1.8414
5 S A -1.3490
6 G A -1.4039
7 S A -1.2665
8 L A 0.0000
9 E A -1.6762
10 V A -0.5823
11 V A 0.3820
12 E A -1.3311
13 A A -1.1065
14 S A -1.1072
15 P A -1.8523
16 T A -1.1986
17 S A -1.1844
18 L A 0.0000
19 Q A -1.0136
20 F A 0.0000
21 S A -0.9813
22 W A 0.0000
23 D A -2.1743
24 A A -1.4589
25 F A 0.0000
26 H A -1.1369
27 R A -0.4610
28 Y A 0.7317
29 H A 0.0230
30 N A -0.6804
31 G A 0.0577
32 F A 1.3939
33 T A 0.6034
34 H A 0.0362
35 P A -0.4753
36 V A -1.2034
37 R A -1.4617
38 Y A -0.9705
39 Y A 0.0000
40 R A -0.8532
41 F A 0.0000
42 T A 0.0000
43 Y A -0.5430
44 G A -0.8512
45 E A -1.8339
46 T A -1.4630
47 G A -1.3313
48 G A -1.4737
49 N A -1.5560
50 S A -0.9626
51 P A -0.4301
52 V A 0.2694
53 Q A -1.2218
54 E A -1.7881
55 F A -0.6777
56 T A -0.2485
57 V A 0.0000
58 P A -1.1227
59 G A -1.3567
60 S A -1.3923
61 K A -1.9986
62 S A -1.3143
63 T A -0.9140
64 A A 0.0000
65 T A -0.4436
66 V A 0.0000
67 S A -0.8054
68 G A -0.9962
69 L A 0.0000
70 K A -2.5220
71 P A -2.1162
72 G A -1.4414
73 V A -1.5252
74 D A -2.7584
75 Y A 0.0000
76 T A -1.2972
77 F A 0.0000
78 T A 0.0000
79 V A 0.0000
80 Y A -0.2610
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.5006
85 Y A 0.0000
86 P A -0.4593
87 R A -1.1234
88 Y A 0.7011
89 G A 0.7743
90 Y A 1.0874
91 G A 0.2912
92 E A -0.6718
93 S A 0.0000
94 G A -0.7519
95 P A -0.5724
96 V A -0.4687
97 S A -1.0540
98 R A -1.7393
99 N A -2.4080
100 Y A -2.0404
101 R A -2.8451
102 T A 0.0000
103 E A -2.4024
104 L A -1.3684
105 D A -2.7592
106 K A -2.8309
107 P A -1.8273
108 S A -1.6382
109 Q A -1.6621
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018