Project name: query_structure

Status: done

Started: 2026-03-16 21:44:07
Settings
Chain sequence(s) A: MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFNIAYWEPGIGGEAIWLRVPGSERSYDLTGLKPGTEYKVWIAGVKGGASSPPLIARFTT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:44)
Show buried residues

Minimal score value
-3.1061
Maximal score value
1.3951
Average score
-0.7054
Total score value
-63.4871

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.0596
2 L A 0.4304
3 P A -0.1987
4 A A -0.4640
5 P A 0.0000
6 K A -2.0297
7 N A -1.2312
8 L A 0.2258
9 V A 0.9411
10 V A 0.0166
11 S A -0.6242
12 R A -2.0197
13 V A -1.0472
14 T A -1.8069
15 E A -3.0812
16 D A -2.7926
17 S A -2.1139
18 A A 0.0000
19 R A -1.2279
20 L A 0.0000
21 S A -0.3879
22 W A 0.0000
23 T A -1.3025
24 A A -1.4147
25 P A -1.4142
26 D A -2.2734
27 A A -1.4312
28 A A -1.1870
29 F A 0.0000
30 D A -2.4539
31 S A 0.0000
32 F A 0.0000
33 N A -0.6810
34 I A 0.0000
35 A A 0.0000
36 Y A 0.5044
37 W A -0.2505
38 E A -1.0294
39 P A -0.7671
40 G A 0.0898
41 I A 1.2352
42 G A -0.1473
43 G A -0.4693
44 E A -1.2888
45 A A -0.0940
46 I A 1.1221
47 W A 1.1547
48 L A 0.1847
49 R A -1.5999
50 V A 0.0000
51 P A -1.5475
52 G A 0.0000
53 S A -1.6021
54 E A -1.4946
55 R A -1.1559
56 S A -0.6627
57 Y A -0.7499
58 D A -1.6805
59 L A 0.0000
60 T A -1.3723
61 G A -1.5196
62 L A 0.0000
63 K A -3.1061
64 P A -2.6803
65 G A -1.9817
66 T A -2.1238
67 E A -2.6797
68 Y A 0.0000
69 K A -0.9922
70 V A 0.0000
71 W A 1.0894
72 I A 0.0000
73 A A 0.0000
74 G A 0.0000
75 V A -1.3147
76 K A -1.7235
77 G A -1.4247
78 G A -1.1562
79 A A -0.6253
80 S A -0.3742
81 S A 0.0000
82 P A 0.2423
83 P A 0.2252
84 L A 0.8282
85 I A 1.3951
86 A A 0.1750
87 R A -1.7262
88 F A 0.0000
89 T A -1.8366
90 T A -2.0471
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018