Project name: fold_rfinf_1_22024_10_30_13_27_model_3

Status: done

Started: 2026-03-26 12:00:17
Settings
Chain sequence(s) B: AAKEAETQQTYKTILNALKLKVRPVTPEQEAEAKAKAEALSKA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:51)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:52)
Show buried residues

Minimal score value
-4.1955
Maximal score value
1.8759
Average score
-1.6171
Total score value
-69.5367

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A B -1.4590
2 A B -2.0109
3 K B -3.4992
4 E B -3.6176
5 A B -2.9574
6 E B -3.7599
7 T B -2.7231
8 Q B -2.6307
9 Q B -2.7000
10 T B -1.0564
11 Y B 0.0803
12 K B -1.4567
13 T B -0.1079
14 I B 1.2858
15 L B 1.5274
16 N B -0.3362
17 A B 0.5028
18 L B 1.8759
19 K B 0.0362
20 L B 0.8331
21 K B -1.1168
22 V B 0.4887
23 R B -1.1785
24 P B -0.4229
25 V B 0.1864
26 T B -1.2752
27 P B -1.9280
28 E B -3.1505
29 Q B -3.2052
30 E B -3.2182
31 A B -3.4358
32 E B -4.1955
33 A B -3.3595
34 K B -3.9006
35 A B -3.2953
36 K B -3.3324
37 A B -2.2372
38 E B -3.0328
39 A B -1.8047
40 L B -0.3640
41 S B -1.1625
42 K B -1.8828
43 A B -0.5399
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018