Project name: query_structure

Status: done

Started: 2026-03-16 22:51:23
Settings
Chain sequence(s) A: YPVRCLLPSAHGSCADWAARWYFVASVGQCNRFWYGGCHGNANNFASEQECMSSCQGS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:19)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:20)
Show buried residues

Minimal score value
-1.9846
Maximal score value
2.3935
Average score
-0.256
Total score value
-14.8506

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Y A 1.4912
2 P A 1.2529
3 V A 2.3053
4 R A 0.7971
5 C A 0.0000
6 L A 2.3935
7 L A 1.2845
8 P A 0.1541
9 S A -0.2515
10 A A -0.5831
11 H A -0.6262
12 G A -0.7599
13 S A -0.4754
14 C A -0.1462
15 A A -0.3770
16 D A -1.0275
17 W A 0.3800
18 A A 0.2242
19 A A -0.1715
20 R A -0.8026
21 W A -1.2100
22 Y A -0.5010
23 F A 0.0000
24 V A 0.5662
25 A A 0.9716
26 S A 0.7701
27 V A 1.4078
28 G A 0.4089
29 Q A -0.3543
30 C A 0.0000
31 N A -1.2885
32 R A -1.9276
33 F A 0.0000
34 W A 0.5571
35 Y A -0.0882
36 G A 0.0000
37 G A -0.5667
38 C A -0.5190
39 H A -1.1419
40 G A -1.0469
41 N A -0.8184
42 A A -0.0201
43 N A 0.0000
44 N A -0.7494
45 F A 0.0000
46 A A -0.8733
47 S A -1.4009
48 E A -1.8758
49 Q A -1.9141
50 E A -1.9846
51 C A 0.0000
52 M A -1.2192
53 S A -1.3764
54 S A -1.0021
55 C A 0.0000
56 Q A -1.3355
57 G A -0.9325
58 S A -0.4478
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018