Project name: query_structure

Status: done

Started: 2026-03-17 00:42:48
Settings
Chain sequence(s) A: QVQLVESGGGLVQAGGSLRLSCAASGFPVREMNMYWYRQAPGKEREWVAAIASNGQYTHYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNVKDYGSFFWGYDYWGQGTQVTVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:37)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:38)
Show buried residues

Minimal score value
-3.7585
Maximal score value
2.1822
Average score
-0.8017
Total score value
-96.2064

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.3504
2 V A -0.5987
3 Q A -1.1212
4 L A 0.0000
5 V A 0.3071
6 E A 0.0000
7 S A -0.7494
8 G A -1.0497
9 G A -0.8243
10 G A -0.0356
11 L A 1.0197
12 V A -0.0122
13 Q A -1.2664
14 A A -1.4995
15 G A -1.3993
16 G A -0.9236
17 S A -1.2416
18 L A -0.9223
19 R A -2.1454
20 L A 0.0000
21 S A -0.4988
22 C A 0.0000
23 A A -0.3790
24 A A 0.0000
25 S A -0.7599
26 G A -0.9284
27 F A 0.0000
28 P A -1.6487
29 V A 0.0000
30 R A -3.4032
31 E A -2.3015
32 M A 0.0000
33 N A -1.1807
34 M A 0.0000
35 Y A -0.0571
36 W A 0.0000
37 Y A -0.4422
38 R A -1.3672
39 Q A -2.2638
40 A A -2.1371
41 P A -1.4778
42 G A -1.9995
43 K A -3.4718
44 E A -3.7585
45 R A -3.1472
46 E A -2.1248
47 W A -0.6844
48 V A 0.0000
49 A A 0.0000
50 A A 0.0000
51 I A 0.0000
52 A A -1.0856
53 S A -2.1566
54 N A -2.3947
55 G A -1.8057
56 Q A -1.0540
57 Y A 0.1435
58 T A -0.1932
59 H A -1.0404
60 Y A -1.3372
61 A A -1.5704
62 D A -2.5422
63 S A -1.7436
64 V A 0.0000
65 K A -2.7717
66 G A -1.7965
67 R A -1.5353
68 F A 0.0000
69 T A -0.9904
70 I A 0.0000
71 S A -0.6929
72 R A -1.6373
73 D A -2.2547
74 N A -3.1411
75 A A -1.9534
76 K A -2.4552
77 N A -2.1645
78 T A 0.0000
79 V A 0.0000
80 Y A -0.6804
81 L A 0.0000
82 Q A -1.2511
83 M A 0.0000
84 N A -1.4746
85 S A -1.2912
86 L A 0.0000
87 K A -2.5401
88 P A -2.0058
89 E A -2.4114
90 D A 0.0000
91 T A -1.0110
92 A A 0.0000
93 V A -0.6704
94 Y A 0.0000
95 Y A -0.2784
96 C A 0.0000
97 N A 0.0000
98 V A 0.0000
99 K A -1.2286
100 D A -0.1676
101 Y A 1.1128
102 G A 0.5717
103 S A 1.0316
104 F A 2.1822
105 F A 1.9510
106 W A 1.9043
107 G A 0.6894
108 Y A 0.7707
109 D A -1.1196
110 Y A -0.4757
111 W A -0.1020
112 G A -0.2997
113 Q A -1.1004
114 G A 0.0000
115 T A 0.0000
116 Q A -1.1816
117 V A 0.0000
118 T A -0.3320
119 V A 0.0000
120 S A -0.7810
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018