Project name: 216bf7172378ead

Chain sequence(s)	A: VLGAFSDGLAHLDNLKGTFATLSELYGRKKRRQRRR
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:22)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:23)

• Minimal score value: -5.8822
• Maximal score value: 2.6921
• Average score: -1.4114
• Total score value: -50.8115

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	V	A	2.6921
2	L	A	2.5642
3	G	A	1.0709
4	A	A	1.3157
5	F	A	2.2735
6	S	A	0.7079
7	D	A	-0.9556
8	G	A	-0.2017
9	L	A	0.4441
10	A	A	-0.9507
11	H	A	-1.3978
12	L	A	-0.5878
13	D	A	-2.1903
14	N	A	-1.8424
15	L	A	-0.3034
16	K	A	-1.4704
17	G	A	-0.9892
18	T	A	0.0364
19	F	A	1.0934
20	A	A	0.2701
21	T	A	0.2565
22	L	A	0.7015
23	S	A	-0.1354
24	E	A	-1.6571
25	L	A	-0.8349
26	Y	A	-0.9011
27	G	A	-2.5466
28	R	A	-4.1316
29	K	A	-4.7678
30	K	A	-5.4006
31	R	A	-5.7265
32	R	A	-5.8822
33	Q	A	-5.7831
34	R	A	-5.7536
35	R	A	-5.3240
36	R	A	-4.5040