Chain sequence(s) |
A: MKGSLSHELEVSLPADQLWQVYSTLRLAQLSAELLPTVISKVEVEEGDGGVGTLLRVTYALGIPGMKYHKERFVKIDHEKRLKEALFVEGGHLDLGFSSYLIRLEILEKGHNSSVIKSTVEYEVDEEHAANASFATTDPFMIIGGAVSEHLLQKKSNCSIMLL
input PDB |
Selected Chain(s) | A |
Distance of aggregation | 10 Å |
FoldX usage | Yes |
Dynamic mode | No |
Automated mutations | Yes |
Downloads | Download all the data |
Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:00) [WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow to prevent this behavior) (00:00:00) [INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:00) [INFO] runJob: Creating pdb object from: input.pdb (00:00:00) [INFO] FoldX: Starting FoldX energy minimalization (00:00:00) [INFO] Analysis: Starting Aggrescan3D on folded.pdb (00:01:59) [INFO] Auto_mut: Residue number 162 from chain A and a score of 3.356 (leucine) selected for automated muatation (00:02:00) [INFO] Auto_mut: Residue number 163 from chain A and a score of 3.247 (leucine) selected for automated muatation (00:02:00) [INFO] Auto_mut: Residue number 161 from chain A and a score of 3.045 (methionine) selected for automated muatation (00:02:00) [INFO] Auto_mut: Residue number 160 from chain A and a score of 2.958 (isoleucine) selected for automated muatation (00:02:00) [INFO] Auto_mut: Residue number 134 from chain A and a score of 1.514 (phenylalanine) selected for automated muatation (00:02:00) [INFO] Auto_mut: Residue number 51 from chain A and a score of 1.208 (valine) selected for automated muatation (00:02:00) [INFO] Auto_mut: Mutating residue number 162 from chain A (leucine) into glutamic acid (00:02:00) [INFO] Auto_mut: Mutating residue number 162 from chain A (leucine) into aspartic acid (00:02:00) [INFO] Auto_mut: Mutating residue number 163 from chain A (leucine) into glutamic acid (00:02:00) [INFO] Auto_mut: Mutating residue number 163 from chain A (leucine) into lysine (00:03:07) [INFO] Auto_mut: Mutating residue number 162 from chain A (leucine) into arginine (00:03:08) [INFO] Auto_mut: Mutating residue number 162 from chain A (leucine) into lysine (00:03:09) [INFO] Auto_mut: Mutating residue number 163 from chain A (leucine) into aspartic acid (00:04:18) [INFO] Auto_mut: Mutating residue number 161 from chain A (methionine) into glutamic acid (00:04:18) [INFO] Auto_mut: Mutating residue number 161 from chain A (methionine) into aspartic acid (00:04:27) [INFO] Auto_mut: Mutating residue number 163 from chain A (leucine) into arginine (00:05:26) [INFO] Auto_mut: Mutating residue number 161 from chain A (methionine) into lysine (00:05:30) [INFO] Auto_mut: Mutating residue number 161 from chain A (methionine) into arginine (00:05:37) [INFO] Auto_mut: Mutating residue number 160 from chain A (isoleucine) into glutamic acid (00:06:36) [INFO] Auto_mut: Mutating residue number 160 from chain A (isoleucine) into aspartic acid (00:06:45) [INFO] Auto_mut: Mutating residue number 134 from chain A (phenylalanine) into glutamic acid Mutating residue number 134 from chain A (phenylalanine) into glutamic acid (00:06:49) [INFO] Auto_mut: Mutating residue number 160 from chain A (isoleucine) into lysine (00:07:43) [INFO] Auto_mut: Mutating residue number 160 from chain A (isoleucine) into arginine (00:07:52) [INFO] Auto_mut: Mutating residue number 134 from chain A (phenylalanine) into lysine (00:07:58) [INFO] Auto_mut: Mutating residue number 134 from chain A (phenylalanine) into aspartic acid Mutating residue number 134 from chain A (phenylalanine) into aspartic acid (00:09:00) [INFO] Auto_mut: Mutating residue number 51 from chain A (valine) into glutamic acid (00:09:02) [INFO] Auto_mut: Mutating residue number 51 from chain A (valine) into aspartic acid (00:09:20) [INFO] Auto_mut: Mutating residue number 134 from chain A (phenylalanine) into arginine (00:10:08) [INFO] Auto_mut: Mutating residue number 51 from chain A (valine) into lysine (00:10:19) [INFO] Auto_mut: Mutating residue number 51 from chain A (valine) into arginine (00:10:36) [INFO] Auto_mut: Effect of mutation residue number 162 from chain A (leucine) into glutamic acid: Energy difference: 0.8764 kcal/mol, Difference in average score from the base case: -0.0583 (00:12:03) [INFO] Auto_mut: Effect of mutation residue number 162 from chain A (leucine) into lysine: Energy difference: 0.3480 kcal/mol, Difference in average score from the base case: -0.0649 (00:12:03) [INFO] Auto_mut: Effect of mutation residue number 162 from chain A (leucine) into aspartic acid: Energy difference: 0.8130 kcal/mol, Difference in average score from the base case: -0.0584 (00:12:03) [INFO] Auto_mut: Effect of mutation residue number 162 from chain A (leucine) into arginine: Energy difference: -0.3196 kcal/mol, Difference in average score from the base case: -0.0591 (00:12:03) [INFO] Auto_mut: Effect of mutation residue number 163 from chain A (leucine) into glutamic acid: Energy difference: 0.1769 kcal/mol, Difference in average score from the base case: -0.0516 (00:12:03) [INFO] Auto_mut: Effect of mutation residue number 163 from chain A (leucine) into lysine: Energy difference: -0.4142 kcal/mol, Difference in average score from the base case: -0.0479 (00:12:03) [INFO] Auto_mut: Effect of mutation residue number 163 from chain A (leucine) into aspartic acid: Energy difference: 0.3092 kcal/mol, Difference in average score from the base case: -0.0520 (00:12:03) [INFO] Auto_mut: Effect of mutation residue number 163 from chain A (leucine) into arginine: Energy difference: -1.4259 kcal/mol, Difference in average score from the base case: -0.0499 (00:12:03) [INFO] Auto_mut: Effect of mutation residue number 161 from chain A (methionine) into glutamic acid: Energy difference: 0.4472 kcal/mol, Difference in average score from the base case: -0.0578 (00:12:03) [INFO] Auto_mut: Effect of mutation residue number 161 from chain A (methionine) into lysine: Energy difference: 0.0125 kcal/mol, Difference in average score from the base case: -0.0568 (00:12:03) [INFO] Auto_mut: Effect of mutation residue number 161 from chain A (methionine) into aspartic acid: Energy difference: 0.7108 kcal/mol, Difference in average score from the base case: -0.0540 (00:12:03) [INFO] Auto_mut: Effect of mutation residue number 161 from chain A (methionine) into arginine: Energy difference: -0.1404 kcal/mol, Difference in average score from the base case: -0.0465 (00:12:03) [INFO] Auto_mut: Effect of mutation residue number 160 from chain A (isoleucine) into glutamic acid: Energy difference: 0.0919 kcal/mol, Difference in average score from the base case: -0.0887 (00:12:03) [INFO] Auto_mut: Effect of mutation residue number 160 from chain A (isoleucine) into lysine: Energy difference: -0.6529 kcal/mol, Difference in average score from the base case: -0.0749 (00:12:03) [INFO] Auto_mut: Effect of mutation residue number 160 from chain A (isoleucine) into aspartic acid: Energy difference: 0.5314 kcal/mol, Difference in average score from the base case: -0.0870 (00:12:03) [INFO] Auto_mut: Effect of mutation residue number 160 from chain A (isoleucine) into arginine: Energy difference: -0.5014 kcal/mol, Difference in average score from the base case: -0.0771 (00:12:03) [INFO] Auto_mut: Effect of mutation residue number 134 from chain A (phenylalanine) into glutamic acid: Energy difference: 0.5521 kcal/mol, Difference in average score from the base case: -0.0624 (00:12:03) [INFO] Auto_mut: Effect of mutation residue number 134 from chain A (phenylalanine) into lysine: Energy difference: 0.1344 kcal/mol, Difference in average score from the base case: -0.0527 (00:12:03) [INFO] Auto_mut: Effect of mutation residue number 134 from chain A (phenylalanine) into aspartic acid: Energy difference: 0.7893 kcal/mol, Difference in average score from the base case: -0.0593 (00:12:03) [INFO] Auto_mut: Effect of mutation residue number 134 from chain A (phenylalanine) into arginine: Energy difference: -0.6753 kcal/mol, Difference in average score from the base case: -0.0573 (00:12:03) [INFO] Auto_mut: Effect of mutation residue number 51 from chain A (valine) into glutamic acid: Energy difference: -0.4647 kcal/mol, Difference in average score from the base case: -0.0827 (00:12:03) [INFO] Auto_mut: Effect of mutation residue number 51 from chain A (valine) into lysine: Energy difference: -0.5181 kcal/mol, Difference in average score from the base case: -0.0880 (00:12:03) [INFO] Auto_mut: Effect of mutation residue number 51 from chain A (valine) into aspartic acid: Energy difference: 0.7330 kcal/mol, Difference in average score from the base case: -0.0793 (00:12:03) [INFO] Auto_mut: Effect of mutation residue number 51 from chain A (valine) into arginine: Energy difference: -1.2424 kcal/mol, Difference in average score from the base case: -0.0913 (00:12:03) [INFO] Main: Simulation completed successfully. (00:12:08) |
The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.
residue index | residue name | chain | Aggrescan3D score | mutation |
---|---|---|---|---|
residue index | residue name | chain | Aggrescan3D score | |
1 | M | A | -1.3810 | |
2 | K | A | -2.2305 | |
3 | G | A | -1.0494 | |
4 | S | A | -0.6473 | |
5 | L | A | 0.1288 | |
6 | S | A | -0.8625 | |
7 | H | A | -1.4196 | |
8 | E | A | -2.3617 | |
9 | L | A | -1.4223 | |
10 | E | A | -2.5343 | |
11 | V | A | -1.5261 | |
12 | S | A | -1.3604 | |
13 | L | A | 0.0000 | |
14 | P | A | -2.2341 | |
15 | A | A | 0.0000 | |
16 | D | A | -2.9143 | |
17 | Q | A | -1.7916 | |
18 | L | A | 0.0000 | |
19 | W | A | 0.0000 | |
20 | Q | A | -2.0262 | |
21 | V | A | 0.0000 | |
22 | Y | A | 0.0000 | |
23 | S | A | 0.0000 | |
24 | T | A | -0.7512 | |
25 | L | A | -0.7885 | |
26 | R | A | -1.0375 | |
27 | L | A | -0.6771 | |
28 | A | A | -0.8873 | |
29 | Q | A | -1.5884 | |
30 | L | A | 0.0000 | |
31 | S | A | 0.0000 | |
32 | A | A | -1.4243 | |
33 | E | A | -1.9872 | |
34 | L | A | -0.4260 | |
35 | L | A | -0.0849 | |
36 | P | A | -0.6337 | |
37 | T | A | 0.1393 | |
38 | V | A | 0.4786 | |
39 | I | A | 0.0000 | |
40 | S | A | -1.1031 | |
41 | K | A | -2.4185 | |
42 | V | A | -1.7192 | |
43 | E | A | -2.0223 | |
44 | V | A | -1.1352 | |
45 | E | A | -1.8661 | |
46 | E | A | -2.3057 | |
47 | G | A | -1.7897 | |
48 | D | A | -2.0352 | |
49 | G | A | -0.8841 | |
50 | G | A | -0.0194 | |
51 | V | A | 1.2082 | |
52 | G | A | -0.0786 | |
53 | T | A | 0.0000 | |
54 | L | A | 0.0000 | |
55 | L | A | 0.0000 | |
56 | R | A | -1.3664 | |
57 | V | A | 0.0000 | |
58 | T | A | -1.0139 | |
59 | Y | A | -0.2369 | |
60 | A | A | 0.2616 | |
61 | L | A | 1.1862 | |
62 | G | A | 0.3181 | |
63 | I | A | 0.4314 | |
64 | P | A | -0.3103 | |
65 | G | A | -1.0209 | |
66 | M | A | -0.8008 | |
67 | K | A | -1.3123 | |
68 | Y | A | -0.9738 | |
69 | H | A | 0.0000 | |
70 | K | A | -0.5075 | |
71 | E | A | -0.2433 | |
72 | R | A | -0.3180 | |
73 | F | A | 0.0000 | |
74 | V | A | 0.9592 | |
75 | K | A | -0.1498 | |
76 | I | A | -0.5004 | |
77 | D | A | -1.8669 | |
78 | H | A | -2.9790 | |
79 | E | A | -3.2500 | |
80 | K | A | -3.2070 | |
81 | R | A | -2.6265 | |
82 | L | A | -1.4000 | |
83 | K | A | 0.0000 | |
84 | E | A | 0.0000 | |
85 | A | A | 0.0000 | |
86 | L | A | 0.5295 | |
87 | F | A | 0.0000 | |
88 | V | A | 0.6800 | |
89 | E | A | -0.5486 | |
90 | G | A | -0.9980 | |
91 | G | A | 0.0000 | |
92 | H | A | 0.0000 | |
93 | L | A | -0.6233 | |
94 | D | A | -1.7259 | |
95 | L | A | -0.5868 | |
96 | G | A | -1.5544 | |
97 | F | A | 0.0000 | |
98 | S | A | -0.9548 | |
99 | S | A | -0.5695 | |
100 | Y | A | 0.0000 | |
101 | L | A | 0.1808 | |
102 | I | A | 0.0000 | |
103 | R | A | -0.3495 | |
104 | L | A | -0.2025 | |
105 | E | A | -1.0527 | |
106 | I | A | 0.0000 | |
107 | L | A | -1.9541 | |
108 | E | A | -3.5942 | |
109 | K | A | -3.3484 | |
110 | G | A | -2.6101 | |
111 | H | A | -2.6844 | |
112 | N | A | -2.7301 | |
113 | S | A | -2.4571 | |
114 | S | A | 0.0000 | |
115 | V | A | 0.0000 | |
116 | I | A | 0.0000 | |
117 | K | A | -1.3663 | |
118 | S | A | 0.0000 | |
119 | T | A | 0.0000 | |
120 | V | A | 0.0000 | |
121 | E | A | -0.8420 | |
122 | Y | A | 0.0000 | |
123 | E | A | -1.9985 | |
124 | V | A | 0.0000 | |
125 | D | A | -3.0284 | |
126 | E | A | -3.4826 | |
127 | E | A | -3.1790 | |
128 | H | A | -2.1639 | |
129 | A | A | -1.8457 | |
130 | A | A | -0.6536 | |
131 | N | A | -0.3679 | |
132 | A | A | -0.3006 | |
133 | S | A | 0.5160 | |
134 | F | A | 1.5135 | |
135 | A | A | 0.0000 | |
136 | T | A | -0.1166 | |
137 | T | A | -0.6789 | |
138 | D | A | -1.3514 | |
139 | P | A | -0.2233 | |
140 | F | A | -0.0480 | |
141 | M | A | -0.0636 | |
142 | I | A | 0.8289 | |
143 | I | A | 0.5372 | |
144 | G | A | 0.0000 | |
145 | G | A | -0.2888 | |
146 | A | A | -0.1623 | |
147 | V | A | 0.0000 | |
148 | S | A | 0.0000 | |
149 | E | A | -2.0717 | |
150 | H | A | -1.6859 | |
151 | L | A | -1.4855 | |
152 | L | A | -1.6232 | |
153 | Q | A | -2.7114 | |
154 | K | A | -3.1636 | |
155 | K | A | -2.1520 | |
156 | S | A | -1.2797 | |
157 | N | A | -1.1272 | |
158 | C | A | 0.3135 | |
159 | S | A | 1.2067 | |
160 | I | A | 2.9580 | |
161 | M | A | 3.0446 | |
162 | L | A | 3.3556 | |
163 | L | A | 3.2471 |
Automated mutations analysis
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file.
Mutant |
Energetic effect |
Score comparison |
|||
VR51A | -1.2424 | -0.0913 | View | CSV | PDB |
LR163A | -1.4259 | -0.0499 | View | CSV | PDB |
VK51A | -0.5181 | -0.088 | View | CSV | PDB |
IK160A | -0.6529 | -0.0749 | View | CSV | PDB |
IR160A | -0.5014 | -0.0771 | View | CSV | PDB |
FR134A | -0.6753 | -0.0573 | View | CSV | PDB |
LR162A | -0.3196 | -0.0591 | View | CSV | PDB |
LK163A | -0.4142 | -0.0479 | View | CSV | PDB |
MR161A | -0.1404 | -0.0465 | View | CSV | PDB |
MK161A | 0.0125 | -0.0568 | View | CSV | PDB |
FK134A | 0.1344 | -0.0527 | View | CSV | PDB |
LK162A | 0.348 | -0.0649 | View | CSV | PDB |