Project name: Mb5-11_VLFVVL

Status: done

Started: 2026-07-06 06:36:09
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQVSWDAFHRYHNGFTHPVRYYRLTYGETGGNSPVQEFTVPGSKSTATFSGLKPGVDYTVTVYAVTWYPRYGYGESGPVSLNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:04)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:04)
Show buried residues

Minimal score value
-2.7312
Maximal score value
1.5207
Average score
-0.6851
Total score value
-74.6728

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.2685
2 Q A -0.9742
3 A A 0.0000
4 N A -1.9219
5 S A -1.5393
6 G A 0.0000
7 S A -1.3624
8 L A 0.0000
9 E A -1.8435
10 V A -0.5293
11 V A 0.3784
12 E A -1.2522
13 A A -1.1019
14 S A -1.4375
15 P A -1.7459
16 T A -1.1486
17 S A -1.1193
18 L A 0.0000
19 Q A -0.7240
20 V A 0.0000
21 S A -1.0255
22 W A 0.0000
23 D A -2.3813
24 A A -1.4782
25 F A 0.0000
26 H A -1.1339
27 R A 0.0000
28 Y A 0.9148
29 H A 0.2876
30 N A -0.5448
31 G A 0.1459
32 F A 1.5207
33 T A 0.7798
34 H A 0.2269
35 P A -0.3830
36 V A -0.9633
37 R A -1.5051
38 Y A -0.9658
39 Y A 0.0000
40 R A -0.8706
41 L A 0.0000
42 T A -0.6511
43 Y A -0.3153
44 G A 0.0000
45 E A -1.2596
46 T A -1.0637
47 G A -1.1318
48 G A -1.2404
49 N A -1.4696
50 S A -0.8337
51 P A -0.3574
52 V A 0.3523
53 Q A -1.1668
54 E A -1.7678
55 F A -0.6176
56 T A -0.2584
57 V A 0.0000
58 P A -1.0545
59 G A -1.2651
60 S A -1.1589
61 K A -1.5218
62 S A -1.1831
63 T A -0.7218
64 A A 0.0000
65 T A -0.3122
66 F A 0.0000
67 S A -0.7514
68 G A -0.9816
69 L A 0.0000
70 K A -2.3246
71 P A -1.9174
72 G A -1.1409
73 V A -1.0223
74 D A -1.9911
75 Y A 0.0000
76 T A -0.7047
77 V A 0.0000
78 T A 0.0000
79 V A 0.0000
80 Y A -0.3226
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.5394
85 Y A 0.0000
86 P A -0.4656
87 R A -1.1206
88 Y A 0.6710
89 G A 0.6375
90 Y A 0.9170
91 G A 0.4110
92 E A -0.4858
93 S A 0.0000
94 G A -0.9587
95 P A -0.5684
96 V A -0.3542
97 S A -0.5974
98 L A -0.7172
99 N A -1.7067
100 Y A -1.4834
101 R A -2.3880
102 T A 0.0000
103 E A -1.9768
104 L A -1.0233
105 D A -2.5893
106 K A -2.7312
107 P A -1.7908
108 S A -1.6433
109 Q A -1.6642
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018