Project name: query_structure

Status: done

Started: 2026-03-17 01:10:37
Settings
Chain sequence(s) A: VSDVPRDLEVVAATPTSLLISWDAPAVTVDHYVITYGETGVGWVPGQTFTVPGSKSTATISGLKPGVDYTITVYAYSEWSYFVINPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:30)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:30)
Show buried residues

Minimal score value
-3.5595
Maximal score value
2.7543
Average score
-0.4414
Total score value
-41.0485

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.5439
2 S A -0.0728
3 D A -0.9028
4 V A -1.1877
5 P A 0.0000
6 R A -3.5450
7 D A -3.5595
8 L A 0.0000
9 E A -2.2046
10 V A 0.0535
11 V A 1.5095
12 A A 0.8703
13 A A 0.2919
14 T A -0.5327
15 P A -1.1195
16 T A -0.9934
17 S A -0.5427
18 L A 0.0000
19 L A 0.6920
20 I A 0.0000
21 S A -1.1962
22 W A 0.0000
23 D A -3.3841
24 A A -1.8000
25 P A 0.0000
26 A A -0.0696
27 V A 0.1615
28 T A -0.5035
29 V A -1.1097
30 D A -2.0523
31 H A -1.5961
32 Y A 0.0000
33 V A 0.4265
34 I A 0.0000
35 T A 0.1757
36 Y A -0.0667
37 G A 0.0000
38 E A -0.7052
39 T A -0.5624
40 G A 0.1342
41 V A 1.4385
42 G A 0.8287
43 W A 1.3388
44 V A 0.9238
45 P A -0.0687
46 G A -0.4078
47 Q A -0.5359
48 T A -0.0869
49 F A 0.3537
50 T A 0.1821
51 V A 0.0000
52 P A -1.2924
53 G A -1.5194
54 S A -1.4982
55 K A -2.1692
56 S A -1.5164
57 T A -0.7894
58 A A 0.0000
59 T A 0.2765
60 I A 0.0000
61 S A -0.7179
62 G A -1.0880
63 L A 0.0000
64 K A -2.3755
65 P A -1.6539
66 G A -1.4467
67 V A -1.4395
68 D A -1.9706
69 Y A 0.0000
70 T A -0.6242
71 I A 0.0000
72 T A 0.0000
73 V A 0.0000
74 Y A 0.3028
75 A A 0.0000
76 Y A 0.3550
77 S A 0.0000
78 E A -1.1846
79 W A 0.7227
80 S A 0.0000
81 Y A 2.3782
82 F A 2.7543
83 V A 1.7317
84 I A 0.0000
85 N A -0.8227
86 P A -0.5327
87 I A -0.5298
88 S A -0.4530
89 I A -0.7244
90 N A -1.7520
91 Y A -1.4962
92 R A -2.5702
93 T A -1.5216
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018