Project name: M-2

Status: done

Started: 2026-07-13 12:29:25
Settings
Chain sequence(s) A: DVQLVESGGGLVQPGGSLKLSCAASGFAFDDYAIGWFRQAPGEERLGVSSISSTYGLAYYADSVKGRFTISSDNSKNTVYLQMNSLRPEDTAVYYCAATPIGLIGLDAYEYDYWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 5 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:08)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:09)
Show buried residues

Minimal score value
-2.237
Maximal score value
1.7392
Average score
-0.2091
Total score value
-25.9252

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -1.7464
2 V A -0.3699
3 Q A -1.1554
4 L A 0.0000
5 V A 1.7392
6 E A 0.1127
7 S A -0.2638
8 G A -0.3681
9 G A -0.2831
10 G A 0.0639
11 L A 1.5122
12 V A 0.0000
13 Q A -1.2199
14 P A -0.4191
15 G A -0.5243
16 G A -0.1722
17 S A -0.2404
18 L A -0.1049
19 K A -1.7112
20 L A 0.0000
21 S A -0.0130
22 C A 0.0000
23 A A 0.0344
24 A A 0.0000
25 S A -0.2971
26 G A -0.4267
27 F A 0.1903
28 A A 0.1060
29 F A 0.0000
30 D A -2.1147
31 D A -2.0809
32 Y A -0.1882
33 A A 0.0000
34 I A 0.0000
35 G A 0.0000
36 W A 0.0000
37 F A 0.0000
38 R A -0.3022
39 Q A -0.4923
40 A A -0.1053
41 P A -0.3372
42 G A -0.8087
43 E A -2.0706
44 E A -2.2370
45 R A -0.9293
46 L A 0.3543
47 G A 0.0802
48 V A 0.0000
49 S A 0.0000
50 S A 0.0000
51 I A 0.0000
52 S A 0.0000
53 S A 0.0000
54 T A -0.0115
55 Y A 1.2202
56 G A -0.0588
57 L A 0.8629
58 A A 0.3273
59 Y A 0.8030
60 Y A 0.3946
61 A A -0.2666
62 D A -1.8260
63 S A -0.5343
64 V A 0.0000
65 K A -1.7853
66 G A -0.8348
67 R A -0.4063
68 F A 0.0000
69 T A -0.0381
70 I A 0.0000
71 S A -0.1287
72 S A -0.1575
73 D A -0.5194
74 N A -0.7994
75 S A -0.6338
76 K A -1.8111
77 N A -0.7854
78 T A 0.0000
79 V A 0.0000
80 Y A 0.3222
81 L A 0.0000
82 Q A -0.6453
83 M A 0.0000
84 N A -0.5246
85 S A -0.3342
86 L A 0.0000
87 R A -1.7315
88 P A -0.8226
89 E A -1.8542
90 D A 0.0000
91 T A -0.0201
92 A A 0.0000
93 V A 0.7401
94 Y A 0.0000
95 Y A 0.1400
96 C A 0.0000
97 A A 0.0000
98 A A 0.0000
99 T A 0.0000
100 P A 0.1407
101 I A 1.4637
102 G A 0.0967
103 L A 1.5195
104 I A 0.5767
105 G A 0.0592
106 L A 0.1817
107 D A -1.0785
108 A A 0.0318
109 Y A 1.2241
110 E A -0.2838
111 Y A 0.0000
112 D A -1.7113
113 Y A 0.1570
114 W A 0.3582
115 G A -0.2277
116 Q A -1.2272
117 G A -0.2913
118 T A 0.2568
119 L A 1.6204
120 V A 0.0000
121 T A 0.1555
122 V A 0.0000
123 S A -0.1977
124 S A -0.2418
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018