Project name: 2283675dc4847f2

Status: done

Started: 2026-04-20 08:42:28
Settings
Chain sequence(s) C: EVQLVESGGGLVQPGGSLRLSCAASQYIGSRIAWFRQAPGKGRELVAYGASNSAGDSRFTISRDNAKRMVYLQMNSLRAEDTAVYYCAARTSSASGYADDESIYDYWGQGTQVTVSS
input PDB
Selected Chain(s) C
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:50)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:50)
Show buried residues

Minimal score value
-2.7239
Maximal score value
0.9957
Average score
-0.7971
Total score value
-93.2586

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E C -2.3531
2 V C -1.5319
3 Q C -1.5624
4 L C 0.0000
5 V C 0.6212
6 E C 0.0000
7 S C -0.6830
8 G C -1.0065
9 G C -0.7864
10 G C -0.0680
11 L C 0.9957
12 V C -0.0418
13 Q C -1.3374
14 P C -1.6450
15 G C -1.4681
16 G C -0.9772
17 S C -1.3555
18 L C -1.1276
19 R C -2.2971
20 L C 0.0000
21 S C -0.4860
22 C C 0.0000
23 A C -0.4772
24 A C 0.0000
25 S C -1.1817
26 Q C -1.4923
27 Y C 0.1253
28 I C -0.0503
29 G C -0.4269
30 S C -0.5479
31 R C -0.8029
32 I C 0.0000
33 A C 0.0000
34 W C 0.0000
35 F C 0.0000
36 R C -1.2288
37 Q C -1.7709
38 A C -1.7072
39 P C -1.1737
40 G C -1.6565
41 K C -2.7239
42 G C -2.2788
43 R C -2.4589
44 E C -2.6197
45 L C -1.3826
46 V C 0.0000
47 A C 0.0000
48 Y C -0.1968
49 G C -0.4625
50 A C -0.5810
51 S C -0.6765
52 N C -1.0616
53 S C -0.7351
54 A C -0.8801
55 G C -0.8867
56 D C -1.0257
57 S C -0.9110
58 R C -0.9223
59 F C 0.0000
60 T C -0.9970
61 I C 0.0000
62 S C -0.6948
63 R C -1.2451
64 D C -1.7601
65 N C -1.9863
66 A C -1.5039
67 K C -2.5680
68 R C -2.2044
69 M C -1.1737
70 V C 0.0000
71 Y C -0.7114
72 L C 0.0000
73 Q C -1.6532
74 M C 0.0000
75 N C -1.4941
76 S C -1.2704
77 L C 0.0000
78 R C -2.4787
79 A C -1.8331
80 E C -2.2864
81 D C 0.0000
82 T C -0.9174
83 A C 0.0000
84 V C -0.4442
85 Y C 0.0000
86 Y C -0.2918
87 C C 0.0000
88 A C 0.0000
89 A C 0.0000
90 R C 0.0000
91 T C -0.5548
92 S C -0.5145
93 S C -0.3235
94 A C -0.2091
95 S C -0.0810
96 G C -0.2145
97 Y C 0.2579
98 A C -0.5999
99 D C -2.1078
100 D C -1.6947
101 E C -1.8531
102 S C -0.9919
103 I C -0.6491
104 Y C 0.0000
105 D C -1.3974
106 Y C -0.7959
107 W C -0.1847
108 G C -0.2383
109 Q C -0.9084
110 G C 0.0000
111 T C -0.7413
112 Q C -0.9938
113 V C 0.0000
114 T C -0.3147
115 V C 0.0000
116 S C -0.7908
117 S C -0.5390
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018