Project name: query_structure

Status: done

Started: 2026-03-16 20:38:51
Settings
Chain sequence(s) A: LQVDIVPSQGEISVGESKFFLCQVAGMLPTCEISWFSPNGEKLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVHGPQCPRLTWSLGLPEATVNVKIFQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:43)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:43)
Show buried residues

Minimal score value
-3.2188
Maximal score value
1.9629
Average score
-0.7303
Total score value
-75.9551

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L A -0.2628
2 Q A -1.4632
3 V A -1.3823
4 D A -1.4457
5 I A 0.0000
6 V A 0.6209
7 P A -0.1103
8 S A -0.8159
9 Q A -1.9696
10 G A 0.0000
11 E A -2.8058
12 I A 0.0000
13 S A -1.1419
14 V A -0.4418
15 G A -1.3270
16 E A -2.1868
17 S A -0.9606
18 K A -0.2715
19 F A 1.9629
20 F A 0.0000
21 L A 0.7084
22 C A 0.0000
23 Q A -1.5496
24 V A 0.0000
25 A A -0.6228
26 G A -0.4006
27 M A -0.5907
28 L A -0.3547
29 P A -0.8134
30 T A -0.9925
31 C A 0.0000
32 E A -1.8377
33 I A 0.0000
34 S A 0.0000
35 W A 0.0000
36 F A -1.3416
37 S A -1.3611
38 P A -1.3077
39 N A -2.0949
40 G A -2.2280
41 E A -3.2188
42 K A -2.7585
43 L A -1.6535
44 T A -1.2031
45 P A -0.9425
46 N A -2.3777
47 Q A -2.5504
48 Q A -2.4339
49 R A -1.8759
50 I A 0.0000
51 S A -0.3651
52 V A 0.0000
53 V A 0.8598
54 W A -0.5801
55 N A -1.9472
56 D A -3.0151
57 D A -3.1207
58 S A -2.0284
59 S A 0.0000
60 S A 0.0000
61 T A 0.6533
62 L A 0.0000
63 T A 0.8833
64 I A 0.0000
65 Y A -0.6732
66 N A -1.9899
67 A A 0.0000
68 N A -1.2862
69 I A -0.1911
70 D A -1.4937
71 D A 0.0000
72 A A -0.9205
73 G A -0.4784
74 I A 0.2222
75 Y A 0.0000
76 K A -1.0744
77 C A 0.0000
78 V A 0.0000
79 V A 0.0000
80 H A -1.3092
81 G A -1.2484
82 P A -1.2907
83 Q A -1.7736
84 C A 0.0000
85 P A -1.0512
86 R A -1.3608
87 L A 0.3534
88 T A 0.6292
89 W A 1.2068
90 S A 0.9055
91 L A 1.3252
92 G A 0.1539
93 L A -0.2049
94 P A 0.0000
95 E A -1.5785
96 A A -1.1069
97 T A -0.6651
98 V A 0.0000
99 N A -1.5658
100 V A 0.0000
101 K A -2.0955
102 I A 0.0000
103 F A -0.4226
104 Q A -0.5079
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018