Project name: query_structure

Status: done

Started: 2026-03-16 23:10:50
Settings
Chain sequence(s) A: GFPCGESCVYLPCFTAAIGCSCKSKVCYKN
B: GFPCGESCVYIPCFTAAIGCSSCKSKVCYKN
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:25)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:26)
Show buried residues

Minimal score value
-2.0053
Maximal score value
3.0014
Average score
0.2404
Total score value
14.4224

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.6880
2 F A 0.9658
3 P A 0.0208
4 C A 0.2961
5 G A -0.7519
6 E A -0.5601
7 S A 0.0404
8 C A 0.0000
9 V A 2.0514
10 Y A 2.5679
11 L A 2.6780
12 P A 1.4801
13 C A 0.0000
14 F A 2.2524
15 T A 1.2648
16 A A 1.1238
17 A A 1.4281
18 I A 1.9440
19 G A 0.3272
20 C A 0.0000
21 S A -0.4600
22 C A -0.4761
23 K A -1.9181
24 S A -1.3076
25 K A -1.1260
26 V A -0.5523
27 C A 0.0000
28 Y A -0.7684
29 K A -1.2095
30 N A -1.5462
1 G B -0.6723
2 F B 0.9915
3 P B 0.0796
4 C B 0.3200
5 G B -0.3436
6 E B -0.3467
7 S B 0.0233
8 C B 0.0000
9 V B 1.6659
10 Y B 2.5689
11 I B 3.0014
12 P B 1.6179
13 C B 0.0000
14 F B 2.3374
15 T B 1.2883
16 A B 1.1510
17 A B 1.4329
18 I B 1.9739
19 G B 0.3849
20 C B 0.0000
21 S B -0.6864
22 C B -0.5571
23 K B -2.0053
24 S B -1.4008
25 K B -1.2631
26 V B -0.6420
27 C B 0.0000
28 Y B -0.7837
29 K B -1.2174
30 N B -1.5727
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018