Project name: lanm_A4

Chain sequence(s)	A: APTTTTKVDIAAFDPDKDGTIELKEALAAASAAFDKLDPDKDGTLEAKELKGRVSEADLKKADPDNDGTLEKKEYLAAVEAQFKAANPDNDGTIEARELASPAGSALVNLIR
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)

• Minimal score value: -4.1886
• Maximal score value: 0.0
• Average score: -1.5285
• Total score value: -171.1975

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	A	A	-0.0991
2	P	A	-0.2992
3	T	A	-0.2434
4	T	A	-0.5090
5	T	A	-0.6973
6	T	A	-1.1695
7	K	A	-2.2969
8	V	A	-1.5959
9	D	A	-1.9651
10	I	A	-1.0944
11	A	A	-1.3155
12	A	A	-0.7742
13	F	A	0.0000
14	D	A	0.0000
15	P	A	-1.9310
16	D	A	-3.3293
17	K	A	-3.5693
18	D	A	-3.4453
19	G	A	-2.1774
20	T	A	-1.7114
21	I	A	0.0000
22	E	A	-1.3383
23	L	A	-0.9872
24	K	A	-1.6192
25	E	A	0.0000
26	A	A	0.0000
27	L	A	-0.2112
28	A	A	-0.1847
29	A	A	-0.3026
30	A	A	0.0000
31	S	A	-0.6814
32	A	A	-0.9020
33	A	A	0.0000
34	F	A	0.0000
35	D	A	-3.0115
36	K	A	-3.0270
37	L	A	0.0000
38	D	A	0.0000
39	P	A	-2.7317
40	D	A	-3.6873
41	K	A	-4.1045
42	D	A	-3.6156
43	G	A	-2.8910
44	T	A	-2.5385
45	L	A	0.0000
46	E	A	-1.8500
47	A	A	-2.3231
48	K	A	-2.7393
49	E	A	-2.1335
50	L	A	0.0000
51	K	A	-3.1338
52	G	A	-2.2194
53	R	A	-2.5387
54	V	A	-1.8821
55	S	A	-2.3305
56	E	A	-3.2291
57	A	A	-2.4722
58	D	A	-3.0832
59	L	A	-2.9303
60	K	A	-4.1886
61	K	A	-3.6912
62	A	A	-2.6845
63	D	A	0.0000
64	P	A	-2.6123
65	D	A	-3.5596
66	N	A	-3.8296
67	D	A	-3.5970
68	G	A	-2.6115
69	T	A	-2.3347
70	L	A	0.0000
71	E	A	-2.7244
72	K	A	-2.3101
73	K	A	-2.4287
74	E	A	-2.0164
75	Y	A	0.0000
76	L	A	-0.7408
77	A	A	-0.7392
78	A	A	-0.8653
79	V	A	0.0000
80	E	A	-1.0405
81	A	A	-0.8326
82	Q	A	-0.8366
83	F	A	0.0000
84	K	A	-2.5783
85	A	A	-1.3619
86	A	A	0.0000
87	N	A	0.0000
88	P	A	-2.0947
89	D	A	-3.1711
90	N	A	-3.4755
91	D	A	-3.4034
92	G	A	-2.4283
93	T	A	-1.8557
94	I	A	0.0000
95	E	A	-1.5728
96	A	A	-1.5227
97	R	A	-2.1383
98	E	A	0.0000
99	L	A	0.0000
100	A	A	-1.2126
101	S	A	-0.5895
102	P	A	-0.2862
103	A	A	-0.5160
104	G	A	0.0000
105	S	A	-0.5398
106	A	A	-0.6864
107	L	A	0.0000
108	V	A	0.0000
109	N	A	-1.7445
110	L	A	-1.0498
111	I	A	0.0000
112	R	A	-2.4043