Project name: 2368f20916c60c3

Chain sequence(s)	A: VQLVESGGGVVKPGGSLRLSCAASGDLFRSYTMSWYRQAPGKERELVATIGSPIYTTTYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCNGRFTLGSWGQGTLVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:12)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:13)

• Minimal score value: -3.9852
• Maximal score value: 2.7685
• Average score: -0.4303
• Total score value: -49.0568

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
2	V	A	0.8195
3	Q	A	-0.2834
4	L	A	0.6400
5	V	A	1.2458
6	E	A	-0.4030
7	S	A	-0.7753
8	G	A	-1.4247
9	G	A	-0.4448
10	G	A	0.2032
11	V	A	1.4949
12	V	A	0.3120
13	K	A	-1.5410
14	P	A	-1.9089
15	G	A	-1.6185
16	G	A	-1.0394
17	S	A	-1.2792
18	L	A	-0.7979
19	R	A	-2.1533
20	L	A	0.0000
21	S	A	-0.6559
22	C	A	0.0000
23	A	A	-0.5167
24	A	A	-0.5091
25	S	A	-0.8407
26	G	A	-0.7317
27	D	A	-1.3067
28	L	A	0.3243
29	F	A	1.3207
30	R	A	-0.2819
31	S	A	0.0000
32	Y	A	1.1070
33	T	A	0.3104
34	M	A	0.0000
35	S	A	0.0000
36	W	A	0.0000
37	Y	A	-0.2715
38	R	A	0.0000
39	Q	A	-1.8793
40	A	A	0.0000
41	P	A	-1.5006
42	G	A	-2.0558
43	K	A	-3.5590
44	E	A	-3.9852
45	R	A	-3.3254
46	E	A	-2.2570
47	L	A	-0.2960
48	V	A	0.0000
49	A	A	0.0000
50	T	A	0.1587
51	I	A	0.0000
52	G	A	0.5569
53	S	A	0.4136
54	P	A	0.3780
55	I	A	1.0129
56	Y	A	1.5857
57	T	A	0.7105
58	T	A	0.4139
59	T	A	-0.3005
60	Y	A	-0.6469
61	A	A	-1.1533
62	D	A	-2.5138
63	S	A	-1.8348
64	V	A	0.0000
65	K	A	-2.6596
66	G	A	-1.8095
67	R	A	-1.6623
68	F	A	0.0000
69	T	A	-0.8607
70	I	A	0.0000
71	S	A	-0.1497
72	R	A	-1.0481
73	D	A	-1.7858
74	N	A	-2.3222
75	A	A	-1.7882
76	K	A	-2.6574
77	N	A	-2.3558
78	S	A	0.0000
79	L	A	0.0000
80	Y	A	-0.7229
81	L	A	0.0000
82	Q	A	-1.2029
83	M	A	0.0000
84	N	A	-1.5946
85	S	A	-1.5018
86	L	A	0.0000
87	R	A	-2.9800
88	A	A	-2.0133
89	E	A	-2.5227
90	D	A	0.0000
91	T	A	-0.4395
92	A	A	-0.0850
93	V	A	1.4190
94	Y	A	0.5679
95	Y	A	0.2053
96	C	A	0.2174
97	N	A	-0.5121
98	G	A	-0.2766
99	R	A	-0.3764
100	F	A	0.9729
101	T	A	0.8544
102	L	A	1.3157
103	G	A	0.5433
104	S	A	0.2712
105	W	A	0.5736
106	G	A	-0.3610
107	Q	A	-1.2024
108	G	A	-0.3792
109	T	A	0.4426
110	L	A	2.1957
111	V	A	2.7685
112	T	A	1.9734
113	V	A	2.1771
114	S	A	0.7172
115	S	A	0.0809