Project name: query_structure

Status: done

Started: 2026-03-16 21:21:38
Settings
Chain sequence(s) A: MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:48)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:49)
Show buried residues

Minimal score value
-4.3685
Maximal score value
2.2145
Average score
-1.2259
Total score value
-120.1394

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
6 M A 1.6203
7 I A 2.0625
8 P A 0.9602
9 G A 0.6191
10 G A 0.1977
11 L A -0.4632
12 S A -1.2902
13 E A -2.2797
14 A A -1.7994
15 K A -1.7739
16 P A -0.9925
17 A A -1.1690
18 T A -1.3863
19 P A -1.9622
20 E A -2.7682
21 I A 0.0000
22 Q A -2.9334
23 E A -3.5527
24 I A 0.0000
25 V A 0.0000
26 D A -4.0447
27 K A -2.9387
28 V A 0.0000
29 K A -2.9402
30 P A -2.6553
31 Q A -2.9454
32 L A 0.0000
33 E A -3.9943
34 E A -4.3685
35 K A -3.7716
36 T A -2.7648
37 N A -3.5067
38 E A -3.0360
39 T A -1.6442
40 Y A -1.6794
43 G A -2.1102
44 K A -3.0146
45 L A 0.0000
46 E A -2.8226
47 A A -1.7757
48 V A -0.6344
49 Q A -1.4076
50 Y A 0.0000
51 K A 0.0000
52 T A -0.4047
53 Q A 0.4601
54 V A 1.5997
55 V A 2.2145
56 A A 1.2207
57 G A 1.0473
58 T A 0.7796
59 N A 0.5524
60 Y A 0.0000
61 Y A 0.0000
62 I A 0.0000
63 K A 0.0000
64 V A 0.0000
65 R A -3.2227
66 A A -2.9405
67 G A -2.8030
68 D A -3.5660
92 N A -3.4811
93 K A -4.0349
94 Y A 0.0000
95 M A 0.0000
96 H A 0.0000
97 L A 0.0000
98 K A 0.1840
99 V A 0.0000
100 F A 0.8831
101 K A -0.0994
102 S A -0.1430
102A L A 0.8682
103 P A -0.4040
104 G A -1.6872
105 Q A -2.5035
105A N A -2.9600
106 E A -2.8509
107 D A -2.5081
108 L A -0.7239
109 V A 0.8983
110 L A 0.1156
111 T A 0.5502
112 G A 0.1178
113 Y A -0.2762
114 Q A -0.7944
115 V A -1.0772
115A D A -2.6373
116 K A -3.2257
117 N A -4.2916
118 K A -4.0826
119 D A -3.7524
120 D A -3.4371
121 E A -3.1941
122 L A 0.0000
123 T A -0.9955
124 G A -0.5157
125 F A -0.0524
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018