Project name: query_structure

Status: done

Started: 2026-03-16 22:58:10
Settings
Chain sequence(s) A: CGADQFRCGNGSCVPRAWRCDGVDDCGDGSDEAPEICETPTCQSNEFRCRSGRCIPQHWLCDGLNDCGDGSDESQQCSAPASEPPGSLSL
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:43)
Show buried residues

Minimal score value
-3.195
Maximal score value
1.7929
Average score
-1.3159
Total score value
-118.4266

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 C A -0.2643
2 G A -0.9785
3 A A -1.0810
4 D A -2.4101
5 Q A -1.8839
6 F A -1.6155
7 R A -2.4172
8 C A 0.0000
9 G A -2.0879
10 N A -2.5595
11 G A -1.7685
12 S A -1.4074
13 C A -1.0087
14 V A 0.0000
15 P A -1.3315
16 R A -2.1118
17 A A -0.9873
18 W A -0.7141
19 R A -1.3918
20 C A -0.9707
21 D A -1.6699
22 G A -0.8656
23 V A -0.1033
24 D A -2.2094
25 D A -1.7217
26 C A 0.0000
27 G A -2.2375
28 D A -3.1151
29 G A -2.1187
30 S A -2.1610
31 D A 0.0000
32 E A -1.6697
33 A A -1.5876
34 P A -1.6392
35 E A -2.3045
36 I A -1.0106
37 C A -1.4253
38 E A -2.3409
39 T A -1.6031
40 P A -1.6318
41 T A -1.0775
42 C A 0.0000
43 Q A -2.0032
44 S A -1.4242
45 N A -1.9543
46 E A -2.1432
47 F A -1.7799
48 R A -2.8072
49 C A 0.0000
50 R A -3.1950
51 S A -2.5965
52 G A -2.6024
53 R A -2.9276
54 C A -2.0652
55 I A 0.0000
56 P A -1.3384
57 Q A -2.0447
58 H A -1.5509
59 W A -0.5601
60 L A -0.8008
61 C A -1.0581
62 D A -1.6873
63 G A -0.7521
64 L A 0.1079
65 N A -1.5540
66 D A -1.3178
67 C A 0.0000
68 G A -2.2049
69 D A -2.8668
70 G A -1.9364
71 S A 0.0000
72 D A 0.0000
73 E A -1.4601
74 S A -1.7110
75 Q A -1.8520
76 Q A -1.7770
77 C A -1.1585
78 S A -0.9689
79 A A -0.6668
80 P A -0.8654
81 A A -0.7757
82 S A -1.5393
83 E A -2.2907
84 P A -1.5587
85 P A -1.0707
86 G A -0.7495
87 S A -0.0524
88 L A 1.5368
89 S A 1.2856
90 L A 1.7929
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018