Project name: 23f109edbaea9e2

Status: done

Started: 2026-07-01 15:24:26
Settings
Chain sequence(s) B: GLTVWTQDAETGALLMQLAEQEGVLRIAYVSVSSSGSKERIAEHTVVPVP
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:25)
Show buried residues

Minimal score value
-2.895
Maximal score value
2.5458
Average score
-0.3853
Total score value
-19.2674

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G B 0.4222
2 L B 1.8419
3 T B 1.7207
4 V B 2.5458
5 W B 1.6804
6 T B -0.0102
7 Q B -1.0217
8 D B -1.3550
9 A B -1.1032
10 E B -1.6607
11 T B -0.6783
12 G B -0.3066
13 A B 0.0276
14 L B 0.8040
15 L B 0.4397
16 M B 0.2024
17 Q B -1.2373
18 L B -0.7653
19 A B 0.0000
20 E B -2.1919
21 Q B -2.8950
22 E B -2.7042
23 G B -1.0222
24 V B 0.3461
25 L B 0.0000
26 R B -1.8246
27 I B -0.8672
28 A B -0.8961
29 Y B 0.6628
30 V B -0.1873
31 S B -0.1792
32 V B 0.1277
33 S B -0.3694
34 S B -0.3667
35 S B -0.5691
36 G B -0.9115
37 S B -1.4299
38 K B -2.2315
39 E B -2.4825
40 R B -1.9330
41 I B 0.4418
42 A B -0.4234
43 E B -2.1748
44 H B -1.8758
45 T B -0.7511
46 V B 0.6993
47 V B 1.7752
48 P B 0.9168
49 V B 1.9329
50 P B 0.5700
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018