Project name: 2404d9eca2cba14

Chain sequence(s)	A: EVQLVESGGGLVQPGGSLRLSCAASGFTFYAMGWLRQAPGKEREFVAAISSSGGKTYYADSVKGRFTISRDNSKNTLYLQMNSLRPEDTAVYYCATGPGGTYTSDFRYWGQGTLVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:08)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:08)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:08)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:08)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:08)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:17)

• Minimal score value: -3.5494
• Maximal score value: 1.9595
• Average score: -0.6892
• Total score value: -82.0163

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-1.8663
2	V	A	-1.1449
3	Q	A	-1.2200
4	L	A	0.0000
5	V	A	0.5062
6	E	A	0.0000
7	S	A	-0.3336
8	G	A	-0.6334
9	G	A	0.1404
10	G	A	0.6378
11	L	A	1.2971
12	V	A	0.0000
13	Q	A	-1.3644
14	P	A	-1.4659
15	G	A	-1.3171
16	G	A	-0.8772
17	S	A	-1.0396
18	L	A	-0.8985
19	R	A	-2.1272
20	L	A	0.0000
21	S	A	-0.4665
22	C	A	0.0000
23	A	A	-0.2914
24	A	A	-0.3833
25	S	A	-0.8579
26	G	A	-0.5946
27	F	A	0.8409
28	T	A	0.0000
29	F	A	1.9595
30	Y	A	1.1446
31	A	A	0.0000
32	M	A	0.0000
33	G	A	0.0000
34	W	A	0.0000
35	L	A	-0.1909
36	R	A	0.0000
37	Q	A	-1.6417
38	A	A	-1.5564
39	P	A	-1.3886
40	G	A	-1.9506
41	K	A	-3.3417
42	E	A	-3.5494
43	R	A	-2.6973
44	E	A	-2.2109
45	F	A	-0.7276
46	V	A	0.0000
47	A	A	0.0000
48	A	A	0.0000
49	I	A	0.0000
50	S	A	-0.6131
51	S	A	-0.0930
52	S	A	-0.7046
53	G	A	-1.3957
54	G	A	-1.5148
55	K	A	-1.9424
56	T	A	-0.7273
57	Y	A	-0.1672
58	Y	A	-0.5475
59	A	A	-1.2279
60	D	A	-2.3555
61	S	A	-1.7493
62	V	A	0.0000
63	K	A	-2.5495
64	G	A	-1.7772
65	R	A	-1.3734
66	F	A	0.0000
67	T	A	-0.8255
68	I	A	0.0000
69	S	A	-0.7649
70	R	A	-1.2550
71	D	A	-1.9674
72	N	A	-1.8999
73	S	A	-1.8798
74	K	A	-2.6236
75	N	A	-1.7356
76	T	A	-1.2596
77	L	A	0.0000
78	Y	A	-0.6212
79	L	A	0.0000
80	Q	A	-1.3143
81	M	A	0.0000
82	N	A	-1.3601
83	S	A	-1.1163
84	L	A	0.0000
85	R	A	-1.9828
86	P	A	-1.7783
87	E	A	-2.2198
88	D	A	0.0000
89	T	A	-0.3908
90	A	A	0.0000
91	V	A	0.7820
92	Y	A	0.0000
93	Y	A	0.3736
94	C	A	0.0000
95	A	A	0.0000
96	T	A	0.0000
97	G	A	0.0000
98	P	A	-0.6111
99	G	A	-1.1908
100	G	A	-0.7942
101	T	A	-0.6551
102	Y	A	-0.2954
103	T	A	-0.3177
104	S	A	-1.3326
105	D	A	-2.4051
106	F	A	0.0000
107	R	A	-2.0151
108	Y	A	-0.8097
109	W	A	0.1723
110	G	A	-0.0562
111	Q	A	-0.8844
112	G	A	0.1248
113	T	A	0.5732
114	L	A	1.7259
115	V	A	0.0000
116	T	A	0.3264
117	V	A	0.0000
118	S	A	-0.7848
119	S	A	-0.5986