Project name: obj1 [mutate: GD9C, LI11C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	GD9C,LI11C
Energy difference between WT (input) and mutated protein (by FoldX)	13.2033 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:29)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:50)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:51)

• Minimal score value: -3.3333
• Maximal score value: 1.8447
• Average score: -0.6453
• Total score value: -77.4302

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0063
2	V	C	-0.9165
3	Q	C	-1.2443
4	L	C	0.0000
5	V	C	0.5647
6	E	C	0.2022
7	S	C	-0.4495
8	G	C	-0.8764
9	D	C	-0.0169	mutated: GD9C
10	G	C	1.0527
11	I	C	1.8447	mutated: LI11C
12	V	C	0.1193
13	Q	C	-1.2594
14	P	C	-1.4479
15	G	C	-1.4170
16	G	C	-0.9163
17	S	C	-1.1777
18	L	C	-0.8493
19	R	C	-2.1224
20	L	C	0.0000
21	S	C	-0.5612
22	C	C	0.0000
23	A	C	-0.2018
24	A	C	0.0000
25	S	C	-0.2017
26	D	C	0.0000
27	F	C	1.5458
28	T	C	0.2525
29	F	C	0.0000
30	R	C	-2.0340
31	S	C	-0.8863
32	Y	C	-1.2160
33	E	C	-1.1454
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.2977
40	A	C	-0.9864
41	P	C	-1.2942
42	G	C	-1.4348
43	K	C	-2.1350
44	G	C	-1.0592
45	L	C	0.3944
46	E	C	-0.3909
47	W	C	0.3403
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5832
53	G	C	-1.2458
54	S	C	-1.2302
55	G	C	-1.0834
56	G	C	-0.7345
57	S	C	-0.3026
58	T	C	0.1984
59	Y	C	0.6071
60	Y	C	-0.3570
61	A	C	-1.1391
62	D	C	-2.3446
63	S	C	-1.7152
64	V	C	0.0000
65	K	C	-2.3850
66	G	C	-1.6177
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6725
70	I	C	0.0000
71	S	C	-0.5646
72	R	C	-1.3678
73	D	C	-1.9915
74	N	C	-2.1954
75	S	C	-1.7941
76	K	C	-2.3198
77	N	C	-1.6521
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6727
81	L	C	0.0000
82	Q	C	-1.2042
83	M	C	0.0000
84	N	C	-1.3024
85	S	C	-1.2153
86	L	C	0.0000
87	R	C	-2.4754
88	A	C	-1.8935
89	E	C	-2.3439
90	D	C	0.0000
91	T	C	-0.3788
92	A	C	0.0000
93	I	C	1.0541
94	Y	C	0.0000
95	Y	C	0.6441
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1907
101	D	C	-3.3333
102	G	C	-2.0866
103	F	C	-1.2310
104	N	C	-2.4286
105	K	C	-3.1848
106	G	C	-1.9076
107	F	C	-0.9859
108	D	C	-1.0994
109	Y	C	-0.2104
110	W	C	0.5562
111	G	C	-0.0702
112	Q	C	-0.8796
113	G	C	0.0942
114	T	C	0.5408
115	L	C	1.7832
116	V	C	0.0000
117	T	C	0.4568
118	V	C	0.0000
119	S	C	-0.6880
120	S	C	-1.0588