Project name: Tie2

Status: done

Started: 2026-06-22 05:29:06
Settings
Chain sequence(s) A: QVQLQQPGAELVRPGASVKLSCKASGYSFTSYWMNWVKQRPGQGLEWIGMIHPSDSETRLNQKFMDKATLTVDKSSSTAYMQLSSPTSEDSAVYYCARGLYGNSWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:17)
Show buried residues

Minimal score value
-2.8669
Maximal score value
2.5221
Average score
-0.5873
Total score value
-128.0361

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.4579
2 V A -1.0485
3 Q A -1.9102
4 L A 0.0000
5 Q A -2.1028
6 Q A 0.0000
7 P A -1.0073
8 G A -0.8436
9 A A -0.1691
10 E A -0.7554
11 L A 0.0344
12 V A 0.0000
13 R A -1.4649
14 P A -1.1139
15 G A -1.0630
16 A A -0.7810
17 S A -1.0751
18 V A -1.2334
19 K A -1.9938
20 L A 0.0000
21 S A -0.8736
22 C A 0.0000
23 K A -1.7554
24 A A 0.0000
25 S A -1.2100
26 G A -1.0081
27 Y A -0.4053
28 S A -0.1398
29 F A 0.0000
30 T A -0.5708
31 S A 0.0311
32 Y A 0.8687
33 W A 0.7625
34 M A 0.0000
35 N A 0.0000
36 W A 0.0000
37 V A 0.0000
38 K A -0.1393
39 Q A -0.6530
40 R A -1.7382
41 P A -1.1795
42 G A -1.3946
43 Q A -1.8612
44 G A -0.8464
45 L A 0.5756
46 E A -0.1581
47 W A 0.3189
48 I A 0.0000
49 G A 0.0000
50 M A -0.3958
51 I A 0.0000
52 H A -1.0015
53 P A 0.0000
54 S A -1.4420
55 D A -2.5347
56 S A -2.1562
57 E A -2.5175
58 T A -1.8312
59 R A -2.2024
60 L A -1.2332
61 N A -1.5437
62 Q A -2.4040
63 K A -2.4886
64 F A 0.0000
65 M A -1.4004
66 D A -2.1070
67 K A -1.5414
68 A A 0.0000
69 T A -0.6850
70 L A 0.0000
71 T A -0.8457
72 V A -0.9185
73 D A -1.5412
74 K A -2.1119
75 S A -1.1632
76 S A -1.0478
77 S A -1.1731
78 T A 0.0000
79 A A 0.0000
80 Y A -0.6017
81 M A 0.0000
82 Q A -1.3916
83 L A 0.0000
84 S A -1.1723
85 S A -1.0274
86 P A 0.0000
87 T A -1.2302
88 S A -1.3663
89 E A -2.0765
90 D A 0.0000
91 S A -0.8068
92 A A 0.0000
93 V A 0.0765
94 Y A 0.0000
95 Y A 0.2211
96 C A 0.0000
97 A A 0.0000
98 R A 0.2811
99 G A 0.0000
100 L A 1.9201
101 Y A 1.6037
102 G A 0.5026
103 N A -0.5556
104 S A -0.3975
105 W A -0.0159
106 G A 0.0000
107 Q A -1.3132
108 G A 0.0000
109 T A 0.0000
110 L A 0.2603
111 V A 0.0000
112 T A -0.3637
113 V A 0.0000
114 S A -0.4789
115 A A -0.4936
116 A A -0.4310
117 S A -0.4346
118 T A -0.6731
119 K A -1.1515
120 G A -1.4691
121 P A 0.0000
122 S A -0.0452
123 V A 0.0000
124 F A 1.2767
125 P A 0.0716
126 L A 0.4675
127 A A -0.7663
128 P A 0.0000
129 S A -1.2145
130 S A -1.3414
131 K A -1.9204
132 S A -1.2114
133 T A -0.9674
134 S A -0.9153
135 G A -0.7833
136 G A -0.6195
137 T A -0.4412
138 A A 0.0000
139 A A 0.1123
140 L A 0.0000
141 G A 0.0000
142 C A 0.0000
143 L A 0.7841
144 V A 0.0000
145 K A -0.2691
146 D A -0.7494
147 Y A 0.0000
148 F A 0.0000
149 P A -0.8791
150 E A -1.0677
151 P A -1.0992
152 V A -0.8425
153 T A -0.6305
154 V A -0.3590
155 S A -0.3754
156 W A 0.0000
157 N A -0.7768
158 S A -0.6757
159 G A -0.5139
160 A A -0.2292
161 L A 0.0093
162 T A -0.2583
163 S A -0.3384
164 G A -0.4050
165 V A 0.1317
166 H A -0.3033
167 T A 0.2130
168 F A 0.8616
169 P A 0.6561
170 A A 1.1693
171 V A 2.5221
172 L A 2.1236
173 Q A 0.7439
174 S A 0.1514
175 S A -0.1892
176 G A 0.2693
177 L A 0.1969
178 Y A 0.6709
179 S A 0.0000
180 L A 0.0000
181 S A 0.6523
182 S A 0.0000
183 V A 0.5126
184 V A 0.0000
185 T A -0.1737
186 V A 0.0000
187 P A -0.5866
188 S A -0.7357
189 S A -0.6559
190 S A -0.5583
191 L A -0.8259
192 G A -1.0820
193 T A -0.8967
194 Q A -1.2496
195 T A -1.1257
196 Y A 0.0000
197 I A -1.3863
198 C A 0.0000
199 N A -1.5381
200 V A 0.0000
201 N A -1.9772
202 H A 0.0000
203 K A -2.8251
204 P A -1.6979
205 S A -1.8362
206 N A -2.6077
207 T A -2.0530
208 K A -2.7321
209 V A -1.8050
210 D A -2.6464
211 K A -2.1410
212 K A -2.3358
213 V A 0.0000
214 E A -2.8669
215 P A -1.8634
216 K A -2.1604
217 S A -0.9791
218 C A 0.1301
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018