Project name: 249341e460d4264

Chain sequence(s)	A: FVNQHLCGSHLVEALYLVCGERGFFYTKPTGGGPRRGIVEQCCTSICSLYQLENYCN
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:41)

• Minimal score value: -2.7002
• Maximal score value: 2.7978
• Average score: -0.3988
• Total score value: -22.7289

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
11	F	A	2.7978
12	V	A	2.1651
13	N	A	0.2361
14	Q	A	-0.1917
15	H	A	-0.6198
16	L	A	0.0000
17	C	A	-0.4896
18	G	A	-0.7066
19	S	A	-0.7361
20	H	A	-1.3024
21	L	A	0.0000
22	V	A	0.2674
23	E	A	-0.9266
24	A	A	0.0000
25	L	A	0.0000
26	Y	A	0.9239
27	L	A	1.8744
28	V	A	1.5568
29	C	A	-0.1807
30	G	A	-0.7359
31	E	A	-1.7894
32	R	A	-1.7043
33	G	A	-0.2120
34	F	A	1.7364
35	F	A	2.1031
36	Y	A	1.2673
37	T	A	0.5306
38	K	A	0.0171
39	P	A	-0.7441
40	T	A	-1.2296
41	G	A	-1.5964
42	G	A	-1.7591
43	G	A	-1.7558
44	P	A	-1.6296
45	R	A	-2.7002
46	R	A	-2.6332
47	G	A	-1.9318
48	I	A	-1.4747
49	V	A	-1.0595
50	E	A	-2.1553
51	Q	A	-1.3614
52	C	A	0.0000
53	C	A	-0.5160
54	T	A	-0.4445
55	S	A	-0.2705
56	I	A	0.6422
57	C	A	0.0000
58	S	A	0.6708
59	L	A	1.1834
60	Y	A	0.6105
61	Q	A	-0.3830
62	L	A	0.0000
63	E	A	-1.5418
64	N	A	-2.1070
65	Y	A	-1.4551
66	C	A	-0.9632
67	N	A	-2.0049