Project name: IL-6

Status: done

Started: 2025-12-25 14:11:21
Settings
Chain sequence(s) A: LTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:08)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:08)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:08)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:08)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:09)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:05:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:46)
Show buried residues

Minimal score value
-3.7554
Maximal score value
0.8404
Average score
-1.2557
Total score value
-208.4452

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
20 L A 0.8404
21 T A -0.2678
22 S A -1.1800
23 S A -1.4518
24 E A -2.1505
25 R A -2.4714
26 I A 0.0000
27 D A 0.0000
28 K A -2.1227
29 Q A -1.4757
30 I A 0.0000
31 R A -2.4671
32 Y A -0.7735
33 I A 0.0000
34 L A -1.6847
35 D A -2.0124
36 G A 0.0000
37 I A 0.0000
38 S A -1.6635
39 A A -1.5842
40 L A 0.0000
41 R A -2.2317
42 K A -3.1753
43 E A -2.7768
44 T A -2.4279
45 C A 0.0000
46 N A -3.6607
47 K A -3.5302
48 S A 0.0000
49 N A -2.7595
50 M A 0.0000
51 C A 0.0000
52 E A -3.7554
53 S A -3.2606
54 S A -2.6639
55 K A -3.0942
56 E A -3.0106
57 A A -1.6432
58 L A -0.1463
59 A A -0.9475
60 E A -1.9430
61 N A -1.7857
62 N A -2.4981
63 L A 0.0000
64 N A -1.9471
65 L A -1.1111
66 P A -1.2601
67 K A -1.4290
68 M A -1.2740
69 A A -1.4936
70 E A -2.6670
71 K A -2.6695
72 D A -1.8953
73 G A 0.0000
74 C A 0.0000
75 F A -1.0334
76 Q A -1.3466
77 S A -1.4655
78 G A -1.5270
79 F A -1.3452
80 N A -1.8925
81 E A -1.8942
82 E A -2.0268
83 T A -1.2556
84 C A 0.0000
85 L A 0.0000
86 V A -0.5742
87 K A -0.6416
88 I A 0.0000
89 I A 0.0000
90 T A -0.3794
91 G A 0.0000
92 L A 0.0000
93 L A -0.7444
94 E A -1.1218
95 F A 0.0000
96 E A -1.2294
97 V A 0.0000
98 Y A 0.0000
99 L A 0.0000
100 E A -2.1955
101 Y A 0.0000
102 L A 0.0000
103 Q A -2.8780
104 N A -3.3136
105 R A -2.6449
106 F A 0.0000
107 E A -3.1614
108 S A -1.9402
109 S A -2.3558
110 E A -3.4625
111 E A -3.4633
112 Q A -2.6526
113 A A 0.0000
114 R A -2.8866
115 A A -1.4265
116 V A 0.0000
117 Q A -0.9299
118 M A 0.2027
119 S A 0.0000
120 T A 0.0000
121 K A -0.4998
122 V A 0.1052
123 L A 0.0000
124 I A 0.0000
125 Q A -1.8334
126 F A -1.3808
127 L A 0.0000
128 Q A -2.6115
129 K A -3.0015
130 K A -2.8014
131 A A -2.8412
132 K A -3.2659
133 N A -2.6343
134 L A -2.3406
135 D A -2.3681
136 A A -1.8232
137 I A 0.0000
138 T A -0.6715
139 T A -0.6289
140 P A -1.0784
141 D A -1.9349
142 P A -1.1564
143 T A -0.7724
144 T A -0.6963
145 N A 0.0000
146 A A -0.5522
147 S A -0.6741
148 L A -0.8465
149 L A -0.8441
150 T A -1.1542
151 K A -2.1572
152 L A 0.0000
153 Q A -2.0059
154 A A -1.6326
155 Q A -1.6900
156 N A -1.7944
157 Q A -1.6316
158 W A -0.2944
159 L A -0.3994
160 Q A -1.1911
161 D A -0.9349
162 M A 0.0000
163 T A 0.0000
164 T A 0.0000
165 H A 0.0000
166 L A 0.0000
167 I A 0.0000
168 L A 0.0000
169 R A -2.2379
170 S A -1.7764
171 F A 0.0000
172 K A -2.8248
173 E A -2.7848
174 F A 0.0000
175 L A 0.0000
176 Q A -2.3153
177 S A -1.5596
178 S A 0.0000
179 L A 0.0000
180 R A -2.7592
181 A A 0.0000
182 L A 0.0000
183 R A -3.0976
184 Q A -2.5419
185 M A -1.4019
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018