Project name: 2519e0683be36b8

Chain sequence(s)	A: NFMLTQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNVVFGGGTKLTVL
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:25)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:26)

• Minimal score value: -2.2379
• Maximal score value: 1.8597
• Average score: -0.5676
• Total score value: -62.4311

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	N	A	-1.1327
2	F	A	0.0000
3	M	A	0.8075
4	L	A	0.0000
5	T	A	-0.0050
6	Q	A	-0.5190
7	P	A	-0.9467
8	H	A	-1.5263
9	S	A	-1.1080
10	V	A	-0.5496
11	S	A	-0.2690
12	E	A	-0.7713
13	S	A	-0.5639
14	P	A	-1.1726
15	G	A	-1.6828
16	K	A	-2.0590
17	T	A	-1.2498
18	V	A	0.0000
19	T	A	-0.1815
20	I	A	0.0000
21	S	A	-0.2786
22	C	A	0.0000
23	T	A	-0.2627
24	R	A	0.0000
25	S	A	-0.3098
26	S	A	-0.6300
27	G	A	-0.8832
28	S	A	-0.8767
29	I	A	0.0000
30	A	A	-0.3414
31	S	A	-0.3276
32	N	A	-0.2864
33	Y	A	0.1961
34	V	A	0.0000
35	Q	A	-0.2885
36	W	A	0.0000
37	Y	A	0.1869
38	Q	A	0.0000
39	Q	A	-1.4875
40	R	A	-2.2379
41	P	A	-1.3986
42	G	A	-1.0746
43	S	A	-1.0473
44	S	A	-0.8100
45	P	A	-0.7453
46	T	A	-0.3460
47	T	A	-0.0510
48	V	A	0.0000
49	I	A	0.0000
50	Y	A	-0.8639
51	E	A	-1.4589
52	D	A	-1.3613
53	N	A	-2.0789
54	Q	A	-2.0030
55	R	A	-1.8809
56	P	A	-0.6785
57	S	A	-0.6676
58	G	A	-0.8291
59	V	A	-0.8513
60	P	A	-1.2671
61	D	A	-2.1720
62	R	A	-1.4250
63	F	A	0.0000
64	S	A	-1.2458
65	G	A	-1.1033
66	S	A	-0.9763
67	I	A	-0.4966
68	D	A	-1.3337
69	S	A	-0.9860
70	S	A	-0.7968
71	S	A	-0.7762
72	N	A	-0.9023
73	S	A	-0.6939
74	A	A	0.0000
75	S	A	-0.5196
76	L	A	0.0000
77	T	A	-0.2646
78	I	A	0.0000
79	S	A	-1.2691
80	G	A	-1.5193
81	L	A	0.0000
82	K	A	-2.1293
83	T	A	-1.3129
84	E	A	-2.0061
85	D	A	0.0000
86	E	A	-2.0658
87	A	A	0.0000
88	D	A	-1.5368
89	Y	A	0.0000
90	Y	A	0.0935
91	C	A	0.0000
92	Q	A	1.2135
93	S	A	0.0000
94	Y	A	0.7821
95	D	A	-0.5629
96	S	A	-0.4664
97	S	A	-0.5526
98	N	A	-0.0206
99	V	A	1.6393
100	V	A	1.5565
101	F	A	1.8597
102	G	A	0.6032
103	G	A	-0.3925
104	G	A	-0.6704
105	T	A	0.0000
106	K	A	-1.9072
107	L	A	0.0000
108	T	A	-0.6239
109	V	A	-0.4027
110	L	A	1.1220