Project name: 2537bd25a6f3161

Status: done

Started: 2026-06-26 11:59:27
Settings
Chain sequence(s) A: MSHHHHHHSGSMDYITFPKPKSKEDLKENMKKYVEWHKSKGWEITLEDIKDWIWSMAELAEPEYPGLKEEAEELIKELEKENS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:04)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:05)
Show buried residues

Minimal score value
-4.3805
Maximal score value
1.3509
Average score
-1.7229
Total score value
-143.0011

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.5447
2 S A -0.6256
3 H A -1.7444
4 H A -2.3526
5 H A -2.7729
6 H A -2.7899
7 H A -2.5949
8 H A -2.2602
9 S A -1.3428
10 G A -1.1141
11 S A -0.4984
12 M A 0.3826
13 D A -0.5145
14 Y A 1.2349
15 I A 1.3509
16 T A 0.4154
17 F A -0.2575
18 P A -1.2028
19 K A -1.6362
20 P A 0.0000
21 K A -2.9268
22 S A -2.3518
23 K A -3.3554
24 E A -3.3607
25 D A -3.1384
26 L A 0.0000
27 K A -2.8400
28 E A -3.5374
29 N A 0.0000
30 M A -2.0594
31 K A -3.0899
32 K A -2.8531
33 Y A -1.5599
34 V A -1.9513
35 E A -3.1788
36 W A -1.6475
37 H A -1.8124
38 K A -2.8337
39 S A -1.6893
40 K A -1.6351
41 G A -1.4876
42 W A -0.6308
43 E A -1.7694
44 I A -1.0884
45 T A -1.0988
46 L A -1.4539
47 E A -2.7256
48 D A -2.4418
49 I A -1.3588
50 K A -2.1723
51 D A -2.4543
52 W A -1.2734
53 I A 0.0000
54 W A -1.2377
55 S A -0.7165
56 M A 0.0000
57 A A 0.0000
58 E A -1.1354
59 L A 0.1771
60 A A 0.0000
61 E A -1.7016
62 P A -1.2385
63 E A -2.1481
64 Y A -1.5102
65 P A -1.6623
66 G A -1.7532
67 L A 0.0000
68 K A -2.6505
69 E A -3.4320
70 E A -3.5706
71 A A 0.0000
72 E A -3.4555
73 E A -3.9474
74 L A 0.0000
75 I A -3.2152
76 K A -3.9181
77 E A -4.1299
78 L A 0.0000
79 E A -4.0499
80 K A -4.3805
81 E A -4.1910
82 N A -3.3250
83 S A -2.2548
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018