Project name: query_structure

Status: done

Started: 2026-03-17 01:26:37
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVLYYHITYGETGSYGGVQEFTVPGSKSTATISGLKPGVDYTITVYAYFGYYQPWSERYSSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:29)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:30)
Show buried residues

Minimal score value
-2.5595
Maximal score value
1.7815
Average score
-0.3492
Total score value
-33.5196

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7815
2 S A 0.7842
3 S A 0.6427
4 V A 0.4740
5 P A 0.0000
6 T A -1.5529
7 K A -2.4257
8 L A 0.0000
9 E A -1.1949
10 V A 0.4642
11 V A 1.7355
12 A A 0.9918
13 A A 0.2980
14 T A -0.5241
15 P A -1.1187
16 T A -0.9998
17 S A -0.5355
18 L A 0.0000
19 L A 0.8565
20 I A 0.0000
21 S A -0.6967
22 W A 0.0000
23 D A -2.5594
24 A A -1.2257
25 P A -0.0131
26 A A 0.4149
27 V A 0.8280
28 T A 0.4571
29 V A 0.5963
30 L A 1.0013
31 Y A 0.6139
32 Y A 0.0000
33 H A -0.0834
34 I A 0.0000
35 T A -0.6181
36 Y A 0.0000
37 G A -0.5386
38 E A -1.3376
39 T A -0.9389
40 G A -0.5666
41 S A 0.0287
42 Y A 1.0842
43 G A 0.2461
44 G A -0.0723
45 V A 0.4998
46 Q A -1.2586
47 E A -1.7722
48 F A -0.6852
49 T A -0.1803
50 V A 0.0000
51 P A -0.3682
52 G A -0.1686
53 S A -0.7380
54 K A -1.6839
55 S A -1.2583
56 T A -0.6002
57 A A 0.0000
58 T A 0.2368
59 I A 0.0000
60 S A -0.6613
61 G A -1.0318
62 L A 0.0000
63 K A -2.3795
64 P A -1.6406
65 G A -1.4356
66 V A -1.4405
67 D A -2.1063
68 Y A 0.0000
69 T A -0.8773
70 I A 0.0000
71 T A -0.1451
72 V A 0.0000
73 Y A 0.6728
74 A A 0.0000
75 Y A 0.2760
76 F A 0.0000
77 G A -0.2345
78 Y A 0.3253
79 Y A 1.0558
80 Q A -0.2415
81 P A -0.2147
82 W A 0.2214
83 S A -0.8415
84 E A -1.9162
85 R A -1.8209
86 Y A 0.2119
87 S A 0.0000
88 S A 0.0841
89 P A 0.2680
90 I A 0.1138
91 S A -0.2722
92 I A -0.5936
93 N A -1.7107
94 Y A -1.4421
95 R A -2.5595
96 T A -1.5033
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018