Project name: query_structure

Status: done

Started: 2026-03-17 01:24:06
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYYITYGETGAAFGYQEFTVPGSKSTATISGLSPGVDYTITVYAYGYPYVKYNKSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:25)
Show buried residues

Minimal score value
-2.6871
Maximal score value
2.0067
Average score
-0.3543
Total score value
-32.9483

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7820
2 S A 0.6015
3 S A 0.0412
4 V A -0.0009
5 P A 0.0000
6 T A -1.6828
7 K A -2.6814
8 L A 0.0000
9 E A -1.9157
10 V A 0.1154
11 V A 1.5490
12 A A 0.9078
13 A A 0.3259
14 T A -0.1907
15 P A -0.8015
16 T A -0.5340
17 S A -0.3066
18 L A 0.0000
19 L A 0.7762
20 I A 0.0000
21 S A -0.9765
22 W A 0.0000
23 D A -2.6871
24 A A -1.2686
25 P A 0.0001
26 A A 0.4438
27 V A 0.6683
28 T A 0.1682
29 V A 0.0056
30 D A -0.4298
31 Y A -0.1268
32 Y A 0.0000
33 Y A 0.2798
34 I A 0.0000
35 T A -0.5985
36 Y A -0.7079
37 G A 0.0000
38 E A -1.0970
39 T A -1.0974
40 G A -0.5037
41 A A 0.1493
42 A A 0.7841
43 F A 1.6988
44 G A 0.3885
45 Y A 0.0045
46 Q A -1.2367
47 E A -1.7756
48 F A -0.4540
49 T A 0.0146
50 V A 0.0000
51 P A -0.8637
52 G A -0.9751
53 S A -1.2515
54 K A -2.1579
55 S A -1.4368
56 T A -0.7668
57 A A 0.0000
58 T A 0.2464
59 I A 0.0000
60 S A -0.4721
61 G A -0.6871
62 L A 0.0000
63 S A -0.8697
64 P A -0.9937
65 G A -1.1005
66 V A -0.9790
67 D A -1.8895
68 Y A 0.0000
69 T A -0.9502
70 I A 0.0000
71 T A -0.1787
72 V A 0.0000
73 Y A 0.2120
74 A A 0.0000
75 Y A 0.5050
76 G A 0.0000
77 Y A 1.5900
78 P A 1.2505
79 Y A 2.0067
80 V A 1.7029
81 K A -0.5799
82 Y A -0.5935
83 N A -1.4270
84 K A -2.3077
85 S A -1.0406
86 P A -0.3789
87 I A 0.0769
88 S A -0.5369
89 I A -0.7389
90 N A -1.7789
91 Y A -1.5165
92 R A -2.3813
93 T A -1.3177
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018