Project name: query_structure

Status: done

Started: 2026-03-16 21:46:09
Settings
Chain sequence(s) A: MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFWIRYFEFLGSGEAIVLTVPGSERSYDLTGLKPGTEYVVNIMGVKGGKISPPLSAIFTTGG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:41)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:41)
Show buried residues

Minimal score value
-2.9494
Maximal score value
2.1697
Average score
-0.5636
Total score value
-51.8537

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.9026
2 L A 0.3005
3 P A -0.0300
4 A A -0.3412
5 P A 0.0000
6 K A -1.8018
7 N A -1.3964
8 L A -0.1347
9 V A 1.2206
10 V A 0.6196
11 S A -0.5909
12 R A -1.8379
13 V A -1.0329
14 T A -1.8154
15 E A -2.8988
16 D A -2.6967
17 S A -2.0286
18 A A 0.0000
19 R A -1.2085
20 L A 0.0000
21 S A -0.3399
22 W A 0.0000
23 T A -1.2004
24 A A -1.3406
25 P A -1.2962
26 D A -2.2609
27 A A -1.4141
28 A A -1.1525
29 F A 0.0000
30 D A -2.4143
31 S A -1.1636
32 F A 0.0000
33 W A 0.5500
34 I A 0.0000
35 R A -0.0688
36 Y A 0.0000
37 F A 0.5974
38 E A 0.4156
39 F A 2.1697
40 L A 1.9015
41 G A 0.3077
42 S A -0.3758
43 G A -0.7943
44 E A -1.7365
45 A A -0.4373
46 I A 0.5249
47 V A 1.0033
48 L A 0.8248
49 T A 0.2841
50 V A 0.0000
51 P A -1.0455
52 G A 0.0000
53 S A -1.5748
54 E A -1.4337
55 R A -1.0883
56 S A -0.6115
57 Y A -0.7183
58 D A -1.7146
59 L A 0.0000
60 T A -1.4153
61 G A -1.4611
62 L A 0.0000
63 K A -2.9494
64 P A -2.5759
65 G A -1.9268
66 T A -1.2325
67 E A -0.0205
68 Y A 0.0000
69 V A 1.1166
70 V A 0.0000
71 N A -0.0261
72 I A 0.0000
73 M A 0.0000
74 G A 0.0000
75 V A -1.0781
76 K A -1.9822
77 G A -1.7685
78 G A -1.7435
79 K A -1.6980
80 I A -0.2463
81 S A 0.0000
82 P A -0.1054
83 P A -0.4238
84 L A -0.5272
85 S A -0.0556
86 A A 0.9085
87 I A 1.7808
88 F A 0.0000
89 T A -0.5270
90 T A 0.0000
91 G A -1.7939
92 G A -1.7291
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018