Project name: 25774fa179850e4

Chain sequence(s)	A: GESTVSVTVSVCPEGWSECGVAIYGYACGRWGCGHFLNSGPNISPSVTESVTEGSE
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:07)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:07)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:07)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:07)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:07)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:27)

• Minimal score value: -2.9479
• Maximal score value: 2.3163
• Average score: -0.0946
• Total score value: -5.2957

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	G	A	-2.0982
2	E	A	-2.9479
3	S	A	-1.4520
4	T	A	-0.3055
5	V	A	1.0398
6	S	A	0.9251
7	V	A	1.7436
8	T	A	1.0794
9	V	A	2.0239
10	S	A	1.6316
11	V	A	1.8198
12	C	A	0.0344
13	P	A	-1.0952
14	E	A	-2.0497
15	G	A	-1.7126
16	W	A	-1.1804
17	S	A	-1.4192
18	E	A	-1.6903
19	C	A	0.0000
20	G	A	0.5457
21	V	A	1.1916
22	A	A	1.3925
23	I	A	2.3163
24	Y	A	1.6495
25	G	A	1.0336
26	Y	A	0.5654
27	A	A	0.0000
28	C	A	0.0000
29	G	A	0.0000
30	R	A	-1.9211
31	W	A	-0.0471
32	G	A	-0.4073
33	C	A	0.0308
34	G	A	0.4267
35	H	A	-0.0474
36	F	A	1.4331
37	L	A	0.7277
38	N	A	-0.6685
39	S	A	-0.6437
40	G	A	-0.4010
41	P	A	-0.9330
42	N	A	-1.0721
43	I	A	0.2458
44	S	A	0.2601
45	P	A	0.9034
46	S	A	1.1792
47	V	A	1.9994
48	T	A	0.4561
49	E	A	-0.4181
50	S	A	0.0202
51	V	A	0.9078
52	T	A	-0.6424
53	E	A	-2.3526
54	G	A	-2.6154
55	S	A	-2.2207
56	E	A	-2.5368