Chain sequence(s) |
A: FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAGFAVTNDGVI
input PDB |
Selected Chain(s) | A |
Distance of aggregation | 10 Å |
FoldX usage | Yes |
Dynamic mode | No |
Automated mutations | Yes |
Downloads | Download all the data |
Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:09) [WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow to prevent this behavior) (00:00:09) [INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:09) [INFO] runJob: Creating pdb object from: input.pdb (00:00:09) [INFO] FoldX: Starting FoldX energy minimalization (00:00:09) [INFO] Analysis: Starting Aggrescan3D on folded.pdb (00:02:10) [INFO] Auto_mut: Residue number 294 from chain A and a score of 2.558 (isoleucine) selected for automated muatation (00:02:12) [INFO] Auto_mut: Residue number 286 from chain A and a score of 2.112 (phenylalanine) selected for automated muatation (00:02:12) [INFO] Auto_mut: Residue number 293 from chain A and a score of 1.852 (valine) selected for automated muatation (00:02:12) [INFO] Auto_mut: Residue number 288 from chain A and a score of 1.539 (valine) selected for automated muatation (00:02:12) [INFO] Auto_mut: Residue number 224 from chain A and a score of 1.470 (isoleucine) selected for automated muatation (00:02:12) [INFO] Auto_mut: Residue number 1 from chain A and a score of 1.417 omitted from automated muatation (excluded by the user). (00:02:12) [INFO] Auto_mut: Residue number 228 from chain A and a score of 1.396 (phenylalanine) selected for automated muatation (00:02:12) [INFO] Auto_mut: Mutating residue number 294 from chain A (isoleucine) into glutamic acid (00:02:13) [INFO] Auto_mut: Mutating residue number 294 from chain A (isoleucine) into aspartic acid (00:02:13) [INFO] Auto_mut: Mutating residue number 286 from chain A (phenylalanine) into glutamic acid Mutating residue number 286 from chain A (phenylalanine) into glutamic acid (00:02:13) [INFO] Auto_mut: Mutating residue number 294 from chain A (isoleucine) into arginine (00:03:11) [INFO] Auto_mut: Mutating residue number 286 from chain A (phenylalanine) into lysine (00:03:13) [INFO] Auto_mut: Mutating residue number 294 from chain A (isoleucine) into lysine (00:03:13) [INFO] Auto_mut: Mutating residue number 286 from chain A (phenylalanine) into aspartic acid Mutating residue number 286 from chain A (phenylalanine) into aspartic acid (00:04:12) [INFO] Auto_mut: Mutating residue number 293 from chain A (valine) into glutamic acid (00:04:15) [INFO] Auto_mut: Mutating residue number 293 from chain A (valine) into aspartic acid (00:04:20) [INFO] Auto_mut: Mutating residue number 286 from chain A (phenylalanine) into arginine (00:05:12) [INFO] Auto_mut: Mutating residue number 293 from chain A (valine) into lysine (00:05:17) [INFO] Auto_mut: Mutating residue number 293 from chain A (valine) into arginine (00:05:21) [INFO] Auto_mut: Mutating residue number 288 from chain A (valine) into glutamic acid (00:06:15) [INFO] Auto_mut: Mutating residue number 288 from chain A (valine) into aspartic acid (00:06:19) [INFO] Auto_mut: Mutating residue number 224 from chain A (isoleucine) into glutamic acid (00:06:23) [INFO] Auto_mut: Mutating residue number 288 from chain A (valine) into lysine (00:07:17) [INFO] Auto_mut: Mutating residue number 288 from chain A (valine) into arginine (00:07:19) [INFO] Auto_mut: Mutating residue number 224 from chain A (isoleucine) into lysine (00:07:27) [INFO] Auto_mut: Mutating residue number 224 from chain A (isoleucine) into aspartic acid (00:08:22) [INFO] Auto_mut: Mutating residue number 228 from chain A (phenylalanine) into glutamic acid Mutating residue number 228 from chain A (phenylalanine) into glutamic acid (00:08:22) [INFO] Auto_mut: Mutating residue number 228 from chain A (phenylalanine) into aspartic acid Mutating residue number 228 from chain A (phenylalanine) into aspartic acid (00:08:39) [INFO] Auto_mut: Mutating residue number 224 from chain A (isoleucine) into arginine (00:09:23) [INFO] Auto_mut: Mutating residue number 228 from chain A (phenylalanine) into lysine (00:09:30) [INFO] Auto_mut: Mutating residue number 228 from chain A (phenylalanine) into arginine (00:09:41) [INFO] Auto_mut: Effect of mutation residue number 294 from chain A (isoleucine) into glutamic acid: Energy difference: -0.0745 kcal/mol, Difference in average score from the base case: -0.0221 (00:10:56) [INFO] Auto_mut: Effect of mutation residue number 294 from chain A (isoleucine) into lysine: Energy difference: -0.6458 kcal/mol, Difference in average score from the base case: -0.0213 (00:10:56) [INFO] Auto_mut: Effect of mutation residue number 294 from chain A (isoleucine) into aspartic acid: Energy difference: -0.0705 kcal/mol, Difference in average score from the base case: -0.0219 (00:10:56) [INFO] Auto_mut: Effect of mutation residue number 294 from chain A (isoleucine) into arginine: Energy difference: -0.7393 kcal/mol, Difference in average score from the base case: -0.0223 (00:10:56) [INFO] Auto_mut: Effect of mutation residue number 286 from chain A (phenylalanine) into glutamic acid: Energy difference: 0.7218 kcal/mol, Difference in average score from the base case: -0.0338 (00:10:56) [INFO] Auto_mut: Effect of mutation residue number 286 from chain A (phenylalanine) into lysine: Energy difference: 0.5299 kcal/mol, Difference in average score from the base case: -0.0381 (00:10:56) [INFO] Auto_mut: Effect of mutation residue number 286 from chain A (phenylalanine) into aspartic acid: Energy difference: 0.4724 kcal/mol, Difference in average score from the base case: -0.0391 (00:10:56) [INFO] Auto_mut: Effect of mutation residue number 286 from chain A (phenylalanine) into arginine: Energy difference: 0.1014 kcal/mol, Difference in average score from the base case: -0.0398 (00:10:56) [INFO] Auto_mut: Effect of mutation residue number 293 from chain A (valine) into glutamic acid: Energy difference: 2.0554 kcal/mol, Difference in average score from the base case: -0.0271 (00:10:56) [INFO] Auto_mut: Effect of mutation residue number 293 from chain A (valine) into lysine: Energy difference: -0.2384 kcal/mol, Difference in average score from the base case: -0.0261 (00:10:56) [INFO] Auto_mut: Effect of mutation residue number 293 from chain A (valine) into aspartic acid: Energy difference: 0.1687 kcal/mol, Difference in average score from the base case: -0.0269 (00:10:56) [INFO] Auto_mut: Effect of mutation residue number 293 from chain A (valine) into arginine: Energy difference: -0.3846 kcal/mol, Difference in average score from the base case: -0.0273 (00:10:56) [INFO] Auto_mut: Effect of mutation residue number 288 from chain A (valine) into glutamic acid: Energy difference: -0.9905 kcal/mol, Difference in average score from the base case: -0.0341 (00:10:56) [INFO] Auto_mut: Effect of mutation residue number 288 from chain A (valine) into lysine: Energy difference: -0.5496 kcal/mol, Difference in average score from the base case: -0.0329 (00:10:56) [INFO] Auto_mut: Effect of mutation residue number 288 from chain A (valine) into aspartic acid: Energy difference: -0.5554 kcal/mol, Difference in average score from the base case: -0.0338 (00:10:56) [INFO] Auto_mut: Effect of mutation residue number 288 from chain A (valine) into arginine: Energy difference: -0.9262 kcal/mol, Difference in average score from the base case: -0.0343 (00:10:56) [INFO] Auto_mut: Effect of mutation residue number 224 from chain A (isoleucine) into glutamic acid: Energy difference: -0.8256 kcal/mol, Difference in average score from the base case: -0.0366 (00:10:56) [INFO] Auto_mut: Effect of mutation residue number 224 from chain A (isoleucine) into lysine: Energy difference: -0.2829 kcal/mol, Difference in average score from the base case: -0.0435 (00:10:56) [INFO] Auto_mut: Effect of mutation residue number 224 from chain A (isoleucine) into aspartic acid: Energy difference: 0.2781 kcal/mol, Difference in average score from the base case: -0.0395 (00:10:56) [INFO] Auto_mut: Effect of mutation residue number 224 from chain A (isoleucine) into arginine: Energy difference: -0.3173 kcal/mol, Difference in average score from the base case: -0.0477 (00:10:56) [INFO] Auto_mut: Effect of mutation residue number 228 from chain A (phenylalanine) into glutamic acid: Energy difference: 0.5042 kcal/mol, Difference in average score from the base case: -0.0399 (00:10:56) [INFO] Auto_mut: Effect of mutation residue number 228 from chain A (phenylalanine) into lysine: Energy difference: 0.0398 kcal/mol, Difference in average score from the base case: -0.0384 (00:10:56) [INFO] Auto_mut: Effect of mutation residue number 228 from chain A (phenylalanine) into aspartic acid: Energy difference: 1.0028 kcal/mol, Difference in average score from the base case: -0.0344 (00:10:56) [INFO] Auto_mut: Effect of mutation residue number 228 from chain A (phenylalanine) into arginine: Energy difference: -0.0495 kcal/mol, Difference in average score from the base case: -0.0403 (00:10:56) [INFO] Main: Simulation completed successfully. (00:11:01) |
The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.
residue index | residue name | chain | Aggrescan3D score | mutation |
---|---|---|---|---|
residue index | residue name | chain | Aggrescan3D score | |
1 | F | A | 1.4174 | |
2 | S | A | -0.1502 | |
3 | R | A | -1.6747 | |
4 | P | A | -1.0641 | |
5 | G | A | -0.9549 | |
6 | L | A | -0.5309 | |
7 | P | A | -0.1575 | |
8 | V | A | 0.0899 | |
9 | E | A | -0.2653 | |
10 | Y | A | 0.6328 | |
11 | L | A | 0.0000 | |
12 | Q | A | -1.8285 | |
13 | V | A | 0.0000 | |
14 | P | A | -1.6480 | |
15 | S | A | 0.0000 | |
16 | P | A | -1.0352 | |
17 | S | A | -0.7273 | |
18 | M | A | 0.0000 | |
19 | G | A | -1.4091 | |
20 | R | A | -2.0683 | |
21 | D | A | -2.7752 | |
22 | I | A | 0.0000 | |
23 | K | A | -1.3879 | |
24 | V | A | 0.0000 | |
25 | Q | A | 0.0000 | |
26 | F | A | 0.0000 | |
27 | Q | A | 0.0000 | |
28 | S | A | -0.9043 | |
29 | G | A | -1.0828 | |
30 | G | A | -1.6337 | |
31 | N | A | -2.2224 | |
32 | N | A | -2.2040 | |
33 | S | A | 0.0000 | |
34 | P | A | 0.0000 | |
35 | A | A | 0.0000 | |
36 | V | A | 0.0000 | |
37 | Y | A | 0.0000 | |
38 | L | A | 0.0000 | |
39 | L | A | 0.0000 | |
40 | D | A | 0.0000 | |
41 | G | A | 0.0000 | |
42 | L | A | -0.8693 | |
43 | R | A | -2.1267 | |
44 | A | A | 0.0000 | |
45 | Q | A | -2.2844 | |
46 | D | A | -2.8717 | |
47 | D | A | -1.9925 | |
48 | Y | A | -0.3449 | |
49 | N | A | 0.0000 | |
50 | G | A | 0.0000 | |
51 | W | A | 0.0000 | |
52 | D | A | 0.0000 | |
53 | I | A | 0.8452 | |
54 | N | A | -0.0689 | |
55 | T | A | 0.0000 | |
56 | P | A | -0.0292 | |
57 | A | A | 0.0000 | |
58 | F | A | 0.0000 | |
59 | E | A | -0.3763 | |
60 | W | A | -0.1143 | |
61 | Y | A | 0.0000 | |
62 | Y | A | 0.1257 | |
63 | Q | A | -1.0270 | |
64 | S | A | 0.0000 | |
65 | G | A | -0.7843 | |
66 | L | A | 0.0000 | |
67 | S | A | 0.0000 | |
68 | I | A | 0.0000 | |
69 | V | A | 0.0000 | |
70 | M | A | 0.0000 | |
71 | P | A | 0.0000 | |
72 | V | A | 0.0000 | |
73 | G | A | -1.5133 | |
74 | G | A | -0.9706 | |
75 | Q | A | -1.1813 | |
76 | S | A | 0.0000 | |
77 | S | A | 0.0000 | |
78 | F | A | 0.0000 | |
79 | Y | A | 0.0000 | |
80 | S | A | 0.0000 | |
81 | D | A | -0.6564 | |
82 | W | A | 0.0000 | |
83 | Y | A | 0.9420 | |
84 | S | A | 0.0850 | |
85 | P | A | -0.1608 | |
86 | A | A | 0.0000 | |
87 | C | A | -0.5055 | |
88 | G | A | -1.3265 | |
89 | K | A | -1.9812 | |
90 | A | A | -0.8674 | |
91 | G | A | -0.5581 | |
92 | C | A | 0.0743 | |
93 | Q | A | -0.5609 | |
94 | T | A | -0.4814 | |
95 | Y | A | 0.0000 | |
96 | K | A | -0.8906 | |
97 | W | A | 0.0000 | |
98 | E | A | -0.5743 | |
99 | T | A | -0.5162 | |
100 | F | A | 0.0000 | |
101 | L | A | 0.0000 | |
102 | T | A | -0.3691 | |
103 | S | A | -0.5162 | |
104 | E | A | -0.6759 | |
105 | L | A | 0.0000 | |
106 | P | A | 0.0000 | |
107 | Q | A | -1.4471 | |
108 | W | A | -0.8572 | |
109 | L | A | 0.0000 | |
110 | S | A | -1.3037 | |
111 | A | A | -0.8647 | |
112 | N | A | -1.2779 | |
113 | R | A | -1.5969 | |
114 | A | A | -1.6462 | |
115 | V | A | 0.0000 | |
116 | K | A | -1.2689 | |
117 | P | A | -0.9554 | |
118 | T | A | -0.7165 | |
119 | G | A | -0.4539 | |
120 | S | A | 0.0000 | |
121 | A | A | 0.0000 | |
122 | A | A | 0.0000 | |
123 | I | A | 0.0000 | |
124 | G | A | 0.0000 | |
125 | L | A | 0.0000 | |
126 | S | A | 0.0700 | |
127 | M | A | 0.0000 | |
128 | A | A | 0.0000 | |
129 | G | A | 0.0000 | |
130 | S | A | 0.0000 | |
131 | S | A | 0.0000 | |
132 | A | A | 0.0000 | |
133 | M | A | 0.0000 | |
134 | I | A | 0.0000 | |
135 | L | A | 0.0000 | |
136 | A | A | 0.0000 | |
137 | A | A | 0.0000 | |
138 | Y | A | -0.2422 | |
139 | H | A | -0.4460 | |
140 | P | A | -0.9660 | |
141 | Q | A | -1.2786 | |
142 | Q | A | -0.7378 | |
143 | F | A | 0.0000 | |
144 | I | A | -0.3190 | |
145 | Y | A | 0.0000 | |
146 | A | A | 0.0000 | |
147 | G | A | 0.0000 | |
148 | S | A | 0.0000 | |
149 | L | A | 0.0000 | |
150 | S | A | 0.0000 | |
151 | A | A | 0.0000 | |
152 | L | A | 0.1868 | |
153 | L | A | 0.0000 | |
154 | D | A | 0.0000 | |
155 | P | A | 0.0000 | |
156 | S | A | -1.0740 | |
157 | Q | A | -1.1063 | |
158 | G | A | -0.3618 | |
159 | M | A | 0.5948 | |
160 | G | A | 0.0000 | |
161 | P | A | 0.0828 | |
162 | S | A | 0.4548 | |
163 | L | A | 0.8602 | |
164 | I | A | 0.0000 | |
165 | G | A | -0.0849 | |
166 | L | A | 0.6436 | |
167 | A | A | -0.3471 | |
168 | M | A | 0.0000 | |
169 | G | A | -1.4819 | |
170 | D | A | -1.9679 | |
171 | A | A | 0.0000 | |
172 | G | A | 0.0000 | |
173 | G | A | -1.8258 | |
174 | Y | A | 0.0000 | |
175 | K | A | -1.7138 | |
176 | A | A | -0.7667 | |
177 | A | A | -0.6530 | |
178 | D | A | -0.4563 | |
179 | M | A | 0.0000 | |
180 | W | A | 0.0000 | |
181 | G | A | 0.0000 | |
182 | P | A | -0.6322 | |
183 | S | A | -0.8945 | |
184 | S | A | -0.8324 | |
185 | D | A | -1.0613 | |
186 | P | A | -1.0823 | |
187 | A | A | -0.7464 | |
188 | W | A | 0.0000 | |
189 | E | A | -1.9315 | |
190 | R | A | -1.2680 | |
191 | N | A | 0.0000 | |
192 | D | A | 0.0000 | |
193 | P | A | 0.0000 | |
194 | T | A | -1.1513 | |
195 | Q | A | -1.5156 | |
196 | Q | A | 0.0000 | |
197 | I | A | 0.0000 | |
198 | P | A | -1.0289 | |
199 | K | A | -1.3321 | |
200 | L | A | 0.0000 | |
201 | V | A | -1.2637 | |
202 | A | A | -0.9415 | |
203 | N | A | -1.4795 | |
204 | N | A | -1.8490 | |
205 | T | A | 0.0000 | |
206 | R | A | -0.9499 | |
207 | L | A | 0.0000 | |
208 | W | A | 0.0000 | |
209 | V | A | 0.0000 | |
210 | Y | A | 0.0000 | |
211 | C | A | 0.0000 | |
212 | G | A | 0.0000 | |
213 | N | A | -0.9109 | |
214 | G | A | 0.0000 | |
215 | T | A | -0.9595 | |
216 | P | A | -1.2757 | |
217 | N | A | -1.4955 | |
218 | E | A | -1.9079 | |
219 | L | A | -0.8122 | |
220 | G | A | -1.0238 | |
221 | G | A | -0.8885 | |
222 | A | A | -0.6921 | |
223 | N | A | -0.3447 | |
224 | I | A | 1.4705 | |
225 | P | A | 0.7013 | |
226 | A | A | 0.0000 | |
227 | E | A | -0.3211 | |
228 | F | A | 1.3962 | |
229 | L | A | 0.7734 | |
230 | E | A | 0.0000 | |
231 | N | A | -0.8791 | |
232 | F | A | 0.1241 | |
233 | V | A | 0.0000 | |
234 | R | A | -0.6604 | |
235 | S | A | -0.6030 | |
236 | S | A | 0.0000 | |
237 | N | A | 0.0000 | |
238 | L | A | -0.5201 | |
239 | K | A | -1.7278 | |
240 | F | A | 0.0000 | |
241 | Q | A | -1.4549 | |
242 | D | A | -2.4917 | |
243 | A | A | -1.6955 | |
244 | Y | A | 0.0000 | |
245 | N | A | -2.2555 | |
246 | A | A | -1.2573 | |
247 | A | A | -0.9449 | |
248 | G | A | -1.0878 | |
249 | G | A | -1.7243 | |
250 | H | A | -1.6878 | |
251 | N | A | -1.3484 | |
252 | A | A | -0.6367 | |
253 | V | A | 0.1499 | |
254 | F | A | 0.5015 | |
255 | N | A | 0.0574 | |
256 | F | A | 0.1235 | |
257 | P | A | -0.2853 | |
258 | P | A | -0.6169 | |
259 | N | A | -0.9322 | |
260 | G | A | 0.0000 | |
261 | T | A | 0.0000 | |
262 | H | A | -0.6049 | |
263 | S | A | -0.6853 | |
264 | W | A | -0.4478 | |
265 | E | A | -1.0605 | |
266 | Y | A | 0.0000 | |
267 | W | A | 0.0000 | |
268 | G | A | 0.0000 | |
269 | A | A | -0.4306 | |
270 | Q | A | -0.5567 | |
271 | L | A | 0.0000 | |
272 | N | A | -0.8420 | |
273 | A | A | -0.5837 | |
274 | M | A | 0.0000 | |
275 | K | A | -1.0169 | |
276 | G | A | -1.0475 | |
277 | D | A | -0.8735 | |
278 | L | A | 0.0000 | |
279 | Q | A | -0.8019 | |
280 | S | A | -0.6642 | |
281 | S | A | -0.6040 | |
282 | L | A | 0.0000 | |
283 | G | A | -0.3406 | |
284 | A | A | -0.3505 | |
285 | G | A | 0.2720 | |
286 | F | A | 2.1125 | |
287 | A | A | 1.1516 | |
288 | V | A | 1.5391 | |
289 | T | A | -0.2235 | |
290 | N | A | -1.4666 | |
291 | D | A | -1.6190 | |
292 | G | A | -0.1343 | |
293 | V | A | 1.8520 | |
294 | I | A | 2.5580 |
Automated mutations analysis
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file.
Mutant |
Energetic effect |
Score comparison |
|||
VE288A | -0.9905 | -0.0341 | View | CSV | PDB |
VR288A | -0.9262 | -0.0343 | View | CSV | PDB |
IE224A | -0.8256 | -0.0366 | View | CSV | PDB |
IR224A | -0.3173 | -0.0477 | View | CSV | PDB |
IR294A | -0.7393 | -0.0223 | View | CSV | PDB |
IK294A | -0.6458 | -0.0213 | View | CSV | PDB |
VR293A | -0.3846 | -0.0273 | View | CSV | PDB |
FR228A | -0.0495 | -0.0403 | View | CSV | PDB |
VK293A | -0.2384 | -0.0261 | View | CSV | PDB |
FK228A | 0.0398 | -0.0384 | View | CSV | PDB |
FR286A | 0.1014 | -0.0398 | View | CSV | PDB |
FD286A | 0.4724 | -0.0391 | View | CSV | PDB |