Project name: query_structure

Status: done

Started: 2026-03-17 01:24:15
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVDYYYITYGETGASFYFYQTFKVPGSKSTATISGLSPGVDYTITVYAYDWGGYFIGNPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:15)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:17)
Show buried residues

Minimal score value
-2.5919
Maximal score value
3.0701
Average score
-0.1045
Total score value
-9.7139

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.8320
2 S A 0.6827
3 S A 0.4078
4 V A 0.1491
5 P A 0.0000
6 T A -1.5684
7 K A -2.4519
8 L A 0.0000
9 E A -1.2833
10 V A 0.4178
11 V A 1.7085
12 A A 0.9722
13 A A 0.3126
14 T A -0.2039
15 P A -0.8138
16 T A -0.5356
17 S A -0.3172
18 L A 0.0000
19 L A 0.8345
20 I A 0.0000
21 S A -0.7714
22 W A 0.0000
23 D A -2.5919
24 A A -1.1769
25 P A 0.0000
26 A A 0.6572
27 V A 0.8718
28 T A 0.2192
29 V A 0.0047
30 D A -0.9560
31 Y A -0.6681
32 Y A 0.0000
33 Y A 0.4268
34 I A 0.0000
35 T A 0.2206
36 Y A 0.1308
37 G A 0.0000
38 E A -0.8997
39 T A -0.9576
40 G A -0.5410
41 A A 0.6069
42 S A 1.7138
43 F A 2.9383
44 Y A 3.0701
45 F A 2.9152
46 Y A 1.5334
47 Q A -0.0613
48 T A -0.3331
49 F A -0.4318
50 K A -1.2012
51 V A 0.0000
52 P A -1.2789
53 G A -1.2219
54 S A -1.3030
55 K A -2.1827
56 S A -1.4293
57 T A -0.7039
58 A A 0.0000
59 T A 0.2377
60 I A 0.0000
61 S A -0.4782
62 G A -0.6875
63 L A 0.0000
64 S A -0.8769
65 P A -0.9992
66 G A -1.1029
67 V A -0.9885
68 D A -1.9113
69 Y A 0.0000
70 T A -1.0028
71 I A 0.0000
72 T A 0.0000
73 V A 0.0000
74 Y A 0.7455
75 A A 0.0000
76 Y A 1.0860
77 D A 0.5941
78 W A 0.7811
79 G A 0.3342
80 G A 0.7305
81 Y A 1.9726
82 F A 2.5241
83 I A 1.2766
84 G A 0.1628
85 N A -0.8419
86 P A -0.0422
87 I A -0.1199
88 S A -0.5149
89 I A -0.5965
90 N A -1.7050
91 Y A -1.4414
92 R A -2.3893
93 T A -1.2029
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018