Project name: query_structure

Status: done

Started: 2026-03-16 22:57:04
Settings
Chain sequence(s) A: CAKKRNWCGKTEDCCCPMKCVYAWYNEQGSCQSTISALWKKC
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:36)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:36)
Show buried residues

Minimal score value
-2.9756
Maximal score value
2.0331
Average score
-0.5912
Total score value
-24.8298

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 C A -0.5728
2 A A -1.6605
3 K A -2.7350
4 K A -2.8127
5 R A -2.7607
6 N A -1.9151
7 W A -0.3245
8 C A -1.2706
9 G A -2.1016
10 K A -2.7642
11 T A -2.3503
12 E A -2.9756
13 D A -2.9347
14 C A 0.0000
15 C A -0.5714
16 C A -0.4525
17 P A 0.0293
18 M A -1.0912
19 K A -0.9520
20 C A -0.6372
21 V A 0.4005
22 Y A 1.2697
23 A A 1.0524
24 W A 1.4607
25 Y A 1.2893
26 N A -0.1342
27 E A -1.2682
28 Q A -1.2653
29 G A 0.0000
30 S A 0.0000
31 C A 0.0000
32 Q A -1.3648
33 S A -0.1847
34 T A 0.7340
35 I A 2.0331
36 S A 1.0721
37 A A 0.0000
38 L A 1.5108
39 W A 1.0408
40 K A -0.7745
41 K A -0.8820
42 C A 0.0338
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018