Project name: 1d4de4a631db1ee [mutate: WY275A] [mutate: YA275A]

Status: done

Started: 2026-06-16 16:13:35
Settings
Chain sequence(s) A: SMPLGVVTNSTLEVTEIDQLVCKDHLASTDQLKSVGLNLEGSGVSTDIPSATKRWGFRSGVPPKVVSYEAGEWAENCYNLEIKKPDGSECLPPPPDGVRGFPRCRYVHKAQGTGPCPGDYAFHKDGAFFLYDRLASTVIYRGVNFAEGVIAFLILAKPKETYYATSYLEYEIENFGAQHSTTLFKIDNNTFVRLDRPHTPQFLFQLNDTIHLHQQLSNTTGRLIYTLDANINADIGE
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues YA275A
Energy difference between WT (input) and mutated protein (by FoldX) 2.33262 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:01:14)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:01:22)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:31)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:32)
Show buried residues

Minimal score value
-3.4064
Maximal score value
1.7082
Average score
-0.7865
Total score value
-186.3918

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
32 S A -0.1832
33 M A 0.6869
34 P A 0.7722
35 L A 0.0000
36 G A 0.8407
37 V A 0.0000
38 V A -0.1965
39 T A -1.1027
40 N A -1.7189
41 S A -0.9442
42 T A -0.1487
43 L A 0.9032
44 E A -0.1648
45 V A 1.1447
46 T A 0.2928
47 E A -0.1542
48 I A 0.8277
49 D A -1.2120
50 Q A -0.8992
51 L A 0.7179
52 V A 1.5660
53 C A 0.3567
54 K A -1.6110
55 D A -1.6426
56 H A -1.6379
57 L A -0.1981
58 A A -0.3297
59 S A -0.4800
60 T A -0.5625
61 D A -1.6188
62 Q A 0.0000
63 L A 0.3200
64 K A -0.4719
65 S A -0.2672
66 V A -0.2410
67 G A 0.0000
68 L A 0.4973
69 N A 0.0000
70 L A 0.1322
71 E A -1.0990
72 G A -1.2990
73 S A -0.5958
74 G A -0.8091
75 V A -0.2420
76 S A -0.4468
77 T A -0.9374
78 D A -0.5954
79 I A 0.0000
80 P A -1.0241
81 S A -0.9328
82 A A 0.0000
83 T A 0.0000
84 K A -1.9765
85 R A -1.7991
86 W A 0.0000
87 G A -1.1761
88 F A -1.3257
89 R A -2.3118
90 S A -1.7404
91 G A -1.0665
92 V A -0.7009
93 P A -0.9053
94 P A -0.6604
95 K A -0.5739
96 V A 0.9733
97 V A 1.1558
98 S A -0.2030
99 Y A 0.0000
100 E A -2.3194
101 A A -1.5721
102 G A -1.4096
103 E A -1.4387
104 W A -0.9945
105 A A 0.0000
106 E A -2.3687
107 N A 0.0000
108 C A 0.0000
109 Y A 0.0000
110 N A -1.1614
111 L A 0.0000
112 E A -2.8350
113 I A 0.0000
114 K A -2.6430
115 K A -2.1546
116 P A -1.8523
117 D A -2.6036
118 G A -1.9780
119 S A -1.8302
120 E A -2.2686
121 C A -1.5319
122 L A 0.0000
123 P A -0.8439
124 P A -1.0149
125 P A -1.3072
126 P A -1.5332
127 D A -2.3702
128 G A -1.9165
129 V A 0.0000
130 R A -2.6834
131 G A -1.7238
132 F A 0.0000
133 P A -1.5728
134 R A -1.6974
135 C A 0.0000
136 R A -1.2137
137 Y A -0.7723
138 V A 0.0000
139 H A 0.0000
140 K A -1.6149
141 A A 0.0000
142 Q A -2.7539
143 G A 0.0000
144 T A -2.1238
145 G A 0.0000
146 P A -1.1433
147 C A 0.0000
148 P A -1.1369
149 G A -1.8969
150 D A -2.2405
151 Y A -1.0474
152 A A 0.0000
153 F A -0.9141
154 H A 0.0000
155 K A -2.8837
156 D A -2.7981
157 G A -1.6927
158 A A -0.5814
159 F A 0.3676
160 F A 0.0000
161 L A 0.0000
162 Y A 0.0000
163 D A -2.2434
164 R A -2.5525
165 L A -0.7323
166 A A 0.0000
167 S A 0.0000
168 T A 0.1678
169 V A 0.0000
170 I A 0.0000
171 Y A 0.0000
172 R A -1.3737
173 G A -1.5229
174 V A 0.0000
175 N A -1.0606
176 F A 0.0000
177 A A 0.0000
178 E A 0.0000
179 G A 0.0000
180 V A 1.1712
181 I A 1.0555
182 A A 0.9520
183 F A 1.3527
184 L A 1.0157
185 I A 0.0000
186 L A -0.9705
187 A A -1.5684
188 K A -2.6632
189 P A -2.6342
190 K A -3.4064
191 E A -3.0904
192 T A -1.6965
212 Y A 1.7082
213 Y A 1.6571
214 A A 0.5835
215 T A -0.2120
216 S A 0.4415
217 Y A 0.8043
218 L A 0.0000
219 E A -1.2010
220 Y A 0.0000
221 E A -2.3002
222 I A 0.0000
223 E A -2.6454
224 N A -2.0333
225 F A -1.4274
226 G A -1.2149
227 A A -1.5611
228 Q A -2.1101
229 H A -2.0915
230 S A -1.9626
231 T A -1.8604
232 T A 0.0000
233 L A -1.2070
234 F A 0.0000
235 K A -1.0211
236 I A -0.6575
237 D A -1.2616
238 N A -1.7033
239 N A -1.5215
240 T A 0.0000
241 F A -0.3034
242 V A 0.0000
243 R A -1.8784
244 L A -1.8877
245 D A -2.7082
246 R A -2.5306
247 P A -1.6114
248 H A -1.3702
249 T A -0.7883
250 P A 0.0000
251 Q A -0.4850
252 F A 0.0775
253 L A 0.0000
254 F A -0.0110
255 Q A -1.2483
256 L A -0.7775
257 N A -1.1337
258 D A -1.9667
259 T A -1.1711
260 I A -1.1218
261 H A -1.0467
262 L A 0.0509
263 H A -1.2508
264 Q A -1.4850
265 Q A -1.0185
266 L A -1.0151
267 S A -1.4531
268 N A -1.9203
269 T A -1.1122
270 T A -0.8400
271 G A -0.8494
272 R A -0.9028
273 L A 0.2926
274 I A 0.5874
275 A A 0.1168 mutated: YA275A
276 T A 0.0041
277 L A 0.0383
278 D A -1.1541
279 A A -1.0502
280 N A -1.3917
281 I A -1.2940
282 N A -1.6087
283 A A -1.3703
284 D A -1.3572
285 I A 0.3394
286 G A -1.0082
287 E A -2.0902
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018