Project name: 272aba8dff0076e

Chain sequence(s)	A: MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:24)

• Minimal score value: -3.7529
• Maximal score value: 1.1195
• Average score: -1.4356
• Total score value: -80.3935

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.6354
2	T	A	-0.5690
3	Y	A	0.0000
4	K	A	-1.7966
5	L	A	0.0000
6	I	A	-1.1132
7	L	A	0.0000
8	N	A	-1.8715
9	G	A	-2.5398
10	K	A	-2.4413
11	T	A	-1.2565
12	L	A	-1.3013
13	K	A	-2.3569
14	G	A	-1.6787
15	E	A	-2.3488
16	T	A	-1.0677
17	T	A	-1.2071
18	T	A	0.0000
19	E	A	-1.3795
20	A	A	0.0000
21	V	A	1.1195
22	D	A	-0.4211
23	A	A	-0.8018
24	A	A	-0.7777
25	T	A	-1.1179
26	A	A	0.0000
27	E	A	-2.3304
28	K	A	-2.5182
29	V	A	-1.4486
30	F	A	0.0000
31	K	A	-2.7968
32	Q	A	-2.4192
33	Y	A	-1.2898
34	A	A	0.0000
35	N	A	-3.3268
36	D	A	-3.1393
37	N	A	-3.1071
38	G	A	-2.7743
39	V	A	0.0000
40	D	A	-3.7529
41	G	A	-3.0184
42	E	A	-2.8715
43	W	A	-1.6018
44	T	A	-0.6996
45	Y	A	-0.9758
46	D	A	-2.0491
47	D	A	-2.5330
48	A	A	-1.4255
49	T	A	-1.4637
50	K	A	-2.0719
51	T	A	-1.7393
52	F	A	0.0000
53	T	A	-0.7657
54	V	A	0.0000
55	T	A	-2.4441
56	E	A	-3.5392