Project name: query_structure

Status: done

Started: 2026-03-16 20:43:25
Settings
Chain sequence(s) I: RLLGAPVPVDENDEGLQRALQFAMAEYNRASNDKYSSRVVRVISAKRQLVSGIKYILQVEIGRTTCPKSSGDLQSCEFHDEPEMAKYTTCTFVVYSIPWLNQIKLLESKCQ
input PDB
Selected Chain(s) I
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with I chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:42)
Show buried residues

Minimal score value
-3.9064
Maximal score value
2.3021
Average score
-0.7431
Total score value
-82.4809

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
6 R I -0.7843
7 L I 1.5105
8 L I 2.1096
9 G I 1.6116
10 A I 1.1714
11 P I 0.9750
12 V I 1.3092
13 P I -0.5223
14 V I -1.4443
15 D I -3.3606
16 E I -3.9064
17 N I -3.5388
18 D I -3.4305
19 E I -3.6680
20 G I -2.4928
21 L I 0.0000
22 Q I -3.2920
23 R I -3.0616
24 A I 0.0000
25 L I 0.0000
26 Q I -1.8847
27 F I -0.8559
28 A I 0.0000
29 M I 0.0000
30 A I -0.9470
31 E I -1.3524
32 Y I -1.0028
33 N I 0.0000
34 R I -2.5830
35 A I -1.3469
36 S I -1.6677
37 N I -2.2284
38 D I -2.0698
39 K I -2.3628
40 Y I -0.8637
41 S I 0.0000
42 S I 0.0000
43 R I -0.6755
44 V I -0.2553
45 V I -0.0597
46 R I -1.4262
47 V I -0.4033
48 I I 0.4033
49 S I -0.5668
50 A I -0.8325
51 K I -1.2624
52 R I -0.1847
53 Q I 0.9995
54 L I 2.3021
55 V I 1.8438
56 S I 0.7342
57 G I 0.0000
58 I I 1.0766
59 K I 0.3835
60 Y I 0.0000
61 I I -0.3342
62 L I 0.0000
63 Q I -0.5827
64 V I 0.0000
65 E I -0.5417
66 I I 0.0000
67 G I 0.0000
68 R I -1.1940
69 T I 0.0000
70 T I -0.7807
71 C I -0.6073
72 P I -1.1136
73 K I -1.7648
74 S I -1.3783
75 S I -1.0757
76 G I -1.5878
77 D I -2.1843
78 L I -1.0163
79 Q I -1.2628
80 S I -1.1482
81 C I -1.1858
82 E I -2.0280
83 F I -1.3903
84 H I -2.1560
85 D I -3.1729
86 E I -3.4321
87 P I -2.6293
88 E I -3.0214
89 M I -1.7639
90 A I 0.0000
91 K I -2.2076
92 Y I -0.4800
93 T I -0.3917
94 T I -0.6280
95 C I 0.0000
96 T I -1.0460
97 F I 0.0000
98 V I 0.0000
99 V I 0.0000
100 Y I 0.5052
101 S I 0.4167
102 I I 0.6453
103 P I 0.5058
104 W I 1.2844
105 L I 1.1729
106 N I -0.3989
107 Q I -0.3324
108 I I 0.4566
109 K I -0.2131
110 L I 0.2434
111 L I 0.5355
112 E I -1.0958
113 S I -1.1749
114 K I -2.1933
115 C I -1.4245
116 Q I -1.4056
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018