Project name: b728504c5a850bb [mutate: GF14A]

Chain sequence(s)	A: SKIKGSRHWGFILGKRGEPPPGKPADDAGLVSRHWGFILGKRGEPPPGKPADDAGLVSRHWGFILGKRGEPPPGKPADDAGLVSRHWGFILGKRGEPPPGKPADDAGLV
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	GF14A
Energy difference between WT (input) and mutated protein (by FoldX)	2.89183 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:42)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:44)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:21)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:22)

• Minimal score value: -4.4228
• Maximal score value: 3.2167
• Average score: -1.0209
• Total score value: -111.2765

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	S	A	-0.7059
2	K	A	-1.3324
3	I	A	0.3095
4	K	A	-1.6931
5	G	A	-1.3281
6	S	A	-1.6167
7	R	A	-2.6205
8	H	A	-1.4077
9	W	A	0.7280
10	G	A	1.4510
11	F	A	3.2167
12	I	A	2.3767
13	L	A	2.1568
14	F	A	1.3819	mutated: GF14A
15	K	A	-1.6128
16	R	A	-1.9428
17	G	A	-1.7580
18	E	A	-2.6653
19	P	A	-1.5769
20	P	A	-1.4691
21	P	A	-1.4926
22	G	A	-1.6016
23	K	A	-2.4020
24	P	A	-1.9741
25	A	A	-1.9855
26	D	A	-2.9467
27	D	A	-2.8699
28	A	A	-1.2498
29	G	A	-0.5150
30	L	A	-0.2515
31	V	A	0.0570
32	S	A	-1.1966
33	R	A	-1.8258
34	H	A	-1.2343
35	W	A	0.4803
36	G	A	0.0000
37	F	A	2.5708
38	I	A	1.8794
39	L	A	1.6426
40	G	A	-0.6494
41	K	A	-3.0590
42	R	A	-3.0973
43	G	A	-3.0574
44	E	A	-2.8676
45	P	A	-1.8863
46	P	A	-1.5988
47	P	A	-1.4728
48	G	A	-1.5967
49	K	A	-2.3678
50	P	A	-2.1602
51	A	A	-1.8942
52	D	A	-3.1478
53	D	A	-2.7444
54	A	A	-1.5601
55	G	A	-0.1632
56	L	A	0.9556
57	V	A	1.0466
58	S	A	0.0488
59	R	A	-0.8577
60	H	A	-1.1660
61	W	A	0.1317
62	G	A	1.3862
63	F	A	2.5243
64	I	A	1.4686
65	L	A	1.0441
66	G	A	-1.3836
67	K	A	-4.0701
68	R	A	-4.4228
69	G	A	-3.8099
70	E	A	-3.3099
71	P	A	-2.1880
72	P	A	-1.5554
73	P	A	-1.3674
74	G	A	-1.6214
75	K	A	-2.3708
76	P	A	-1.9636
77	A	A	-2.0366
78	D	A	-2.9243
79	D	A	-2.6694
80	A	A	-1.0650
81	G	A	0.2005
82	L	A	1.6511
83	V	A	1.6227
84	S	A	0.1490
85	R	A	-1.3510
86	H	A	-1.2064
87	W	A	0.3086
88	G	A	1.1566
89	F	A	2.7519
90	I	A	1.6874
91	L	A	1.2304
92	G	A	-1.4200
93	K	A	-3.3366
94	R	A	-4.2853
95	G	A	-3.8449
96	E	A	-3.2638
97	P	A	-1.9298
98	P	A	-1.3855
99	P	A	-1.4635
100	G	A	-1.6036
101	K	A	-2.4351
102	P	A	-2.0679
103	A	A	-1.9094
104	D	A	-3.1123
105	D	A	-2.6284
106	A	A	-0.6400
107	G	A	-0.0018
108	L	A	1.9466
109	V	A	2.4270