Project name: 3gax

Status: done

Started: 2025-03-04 13:52:48
Settings
Chain sequence(s) A: GPMDASVEEEGVRRALDDFAVGEYNKASNDMMYHHSRACCQVVRRARKQIVAGVNYFLDVELCCRTTCCTKTQLDNNCCPPFHDQQPHHLKRKAFCSFQQIYAVPWQGTMTLSKSTCQDA
B: GPMDASVEEEGVRRALDFAVGEYNKASNDMMYHHSRRACCQVVRRARKQIVAGVNYFLDVELCCCRTTCTKTQPNNCPFHDQPHHLKRKAFFCSFQIYAVPWQGTMTLSKSTCQDA
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:53)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:54)
Show buried residues

Minimal score value
-3.3353
Maximal score value
2.2345
Average score
-0.7016
Total score value
-149.4462

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
12 G A -0.3399
13 P A -0.3533
14 M A -0.3171
15 D A -1.9500
16 A A -1.5609
17 S A -1.9444
18 V A 0.0000
19 E A -2.6787
20 E A -2.5790
21 E A -3.1899
22 G A -2.3888
23 V A 0.0000
24 R A -2.9166
25 R A -3.0500
26 A A 0.0000
27 L A 0.0000
28 D A -2.3091
29 F A -0.9845
30 A A 0.0000
31 V A -0.6926
32 G A -1.0540
33 E A -1.0873
34 Y A -0.6341
35 N A 0.0000
36 K A -2.1338
37 A A -1.1808
38 S A -1.0809
39 N A -1.3870
40 D A -0.6458
41 M A 0.6441
42 Y A 0.4288
43 H A -0.3604
44 S A 0.0000
45 R A -0.8977
46 A A -0.4522
47 C A 0.0000
48 Q A -0.2612
49 V A 0.0000
50 V A 0.0818
51 R A -1.3424
52 A A 0.0000
53 R A -1.4329
54 K A -0.3712
55 Q A 0.5393
56 I A 2.2320
57 V A 1.6325
58 A A 0.9114
59 G A 0.0000
60 V A 0.0000
61 N A 0.0000
62 Y A 0.0000
63 F A -0.6264
64 L A 0.0000
65 D A 0.0000
66 V A 0.0000
67 E A 0.0000
68 L A 0.0000
69 C A 0.0000
70 R A -0.9503
71 T A 0.0000
72 T A -0.6721
73 C A -0.1649
74 T A 0.0144
75 K A -0.6193
76 T A -0.6306
77 Q A -1.0466
80 L A 0.6423
81 D A -0.4963
82 N A -0.5594
83 C A 0.0000
84 P A 0.0000
85 F A 0.0000
86 H A 0.0000
87 D A -0.8740
88 Q A -1.3250
89 P A -1.3343
90 H A -1.7382
91 L A -1.1959
92 K A -1.6091
93 R A -2.7885
94 K A -2.2473
95 A A -1.5502
96 F A -0.3247
97 C A 0.0000
98 S A -0.4146
99 F A 0.0000
100 Q A -0.8022
101 I A 0.0000
102 Y A 0.5551
103 A A 0.0000
104 V A 0.3582
105 P A -0.0780
106 W A 0.3831
107 Q A -0.8557
108 G A -0.6907
109 T A -0.2472
110 M A -0.0144
111 T A 0.0489
112 L A -0.3083
113 S A -0.8587
114 K A -1.8294
115 S A -1.0188
116 T A -0.5781
117 C A -0.4905
118 Q A -1.9869
119 D A -2.6356
120 A A -1.3118
12 G B -0.1805
13 P B -0.4752
14 M B -0.5878
15 D B -2.1234
16 A B 0.0000
17 S B -1.9181
18 V B 0.0000
19 E B -2.6776
20 E B -2.7184
21 E B -3.2594
22 G B -2.3591
23 V B 0.0000
24 R B -2.6293
25 R B -2.6870
26 A B 0.0000
27 L B 0.0000
28 D B -1.0316
29 F B -0.4364
30 A B 0.0000
31 V B 0.0000
32 G B -0.7443
33 E B -0.9502
34 Y B -0.5673
35 N B -1.1742
36 K B -2.1788
37 A B -1.2121
38 S B -1.1135
39 N B -1.4089
40 D B -0.7677
41 M B 0.4313
42 Y B 0.2216
43 H B -0.5383
44 S B 0.0000
45 R B -0.7811
46 A B 0.0000
47 C B 0.0000
48 Q B -0.3274
49 V B 0.0000
50 V B 0.4186
51 R B -1.5880
52 A B 0.0000
53 R B -1.7055
54 K B -0.4513
55 Q B 0.4271
56 I B 2.2345
57 V B 1.7684
58 A B 0.9830
59 G B 0.0000
60 V B 0.0000
61 N B 0.4891
62 Y B 0.0000
63 F B -0.8120
64 L B 0.0000
65 D B -0.5448
66 V B 0.0000
67 E B -0.8827
68 L B 0.0000
69 C B 0.0000
70 R B -1.0633
71 T B 0.0000
72 T B -0.7213
73 C B -0.7177
74 T B -0.3672
75 K B -1.0615
76 T B -0.9461
77 Q B -1.7668
78 P B -1.5471
79 N B -1.8744
82 N B -1.5624
83 C B -1.2459
84 P B -1.0507
85 F B 0.0000
86 H B 0.0000
87 D B -1.3766
88 Q B -1.7451
89 P B -1.7390
90 H B -1.9815
91 L B -1.5115
92 K B -1.9654
93 R B -3.3353
94 K B -2.8292
95 A B -2.2474
97 C B -0.5433
98 S B -0.6720
99 F B 0.0000
100 Q B 0.0000
101 I B 0.0000
102 Y B 0.4850
103 A B 0.0000
104 V B 0.0000
105 P B -0.2153
106 W B 0.3305
107 Q B -0.9260
108 G B -0.7680
109 T B -0.3730
110 M B -0.1702
111 T B 0.0359
112 L B -0.1690
113 S B -0.7922
114 K B -1.6973
115 S B -0.8931
116 T B -0.6578
117 C B -0.9472
118 Q B -2.3491
119 D B -2.9960
120 A B -1.6358
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018