Project name: 12334 [mutate: TM1695B]

Status: done

Started: 2026-03-14 02:17:17
Settings
Chain sequence(s) A: PPLEPRLGELTVTDITPDSVGLSWTVPEGEFDSFVVQYKDRDGQPQVVPVAADQREVTIPDLEPSRKYKFLLFGIQDGKRRSPVSVEAKTVARGDASPGA
B: PPRLGELWVTDPTPDSLRLSWTVPEGQFDSFVVQFKDKDGPQVVPVEGHERSVTVTPLDAGRKYRFLLYGLLGKKRHGPLTADGTTEARSAMDDTG
input PDB
Selected Chain(s) A,B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues TM1695B
Energy difference between WT (input) and mutated protein (by FoldX) -0.829385 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:01:09)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:01:18)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:31)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:32)
Show buried residues

Minimal score value
-4.2837
Maximal score value
1.3538
Average score
-1.31
Total score value
-256.7529

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1574 P A -0.2282
1575 P A -0.2261
1576 L A -0.1493
1577 E A -2.1336
1578 P A -2.2645
1579 R A -2.5129
1580 L A 0.0000
1581 G A -1.1778
1582 E A -1.4371
1583 L A 0.0000
1584 T A 0.0000
1585 V A 0.0000
1586 T A -0.6797
1587 D A -0.7773
1588 I A -0.5335
1589 T A -0.9241
1590 P A -2.0432
1591 D A -2.0325
1592 S A -1.2432
1593 V A 0.0000
1594 G A 0.0000
1595 L A 0.0000
1596 S A 0.0000
1597 W A 0.0000
1598 T A 0.0000
1599 V A -1.2208
1600 P A -1.3956
1601 E A -1.5354
1602 G A -1.9062
1603 E A -2.9902
1604 F A 0.0000
1605 D A -3.0219
1606 S A -1.8936
1607 F A 0.0000
1608 V A 0.3336
1609 V A 0.0000
1610 Q A -0.3226
1611 Y A 0.0000
1612 K A -3.5416
1613 D A -3.7767
1614 R A -4.2837
1615 D A -3.6051
1616 G A -3.0469
1617 Q A -2.9784
1618 P A -1.9948
1619 Q A -0.9111
1620 V A 0.6154
1621 V A 0.6955
1622 P A 0.3249
1623 V A 0.0000
1624 A A -1.2347
1625 A A -1.9780
1626 D A -2.7696
1627 Q A -1.9739
1628 R A -1.5634
1629 E A -1.6123
1630 V A -0.5386
1631 T A -0.4659
1632 I A 0.0000
1633 P A -1.3136
1634 D A -2.5989
1635 L A 0.0000
1636 E A -3.3987
1637 P A -2.5125
1638 S A -2.3084
1639 R A -3.6543
1640 K A -3.7849
1641 Y A 0.0000
1642 K A -2.9585
1643 F A 0.0000
1644 L A -0.2385
1645 L A 0.0000
1646 F A -0.7910
1647 G A 0.0000
1648 I A -2.4446
1649 Q A -3.2593
1650 D A -3.2635
1651 G A -2.8519
1652 K A -3.5745
1653 R A -2.9758
1654 R A -2.6657
1655 S A -1.3565
1656 P A -0.6536
1657 V A -0.2171
1658 S A -0.6617
1659 V A -1.1273
1660 E A -2.8620
1661 A A 0.0000
1662 K A -3.3418
1663 T A 0.0000
1664 V A -1.7724
1665 A A -2.1370
1666 R A -2.7944
1667 G A -2.2439
1668 D A -2.8073
1669 A A -2.0215
1670 S A -1.5906
1671 P A -1.2178
1672 G A -0.7407
1673 A A -1.3024
1674 P B -1.0522
1675 P B 0.0000
1676 R B -1.9723
1677 L B -1.2980
1678 G B -1.3648
1679 E B -1.8350
1680 L B 0.0000
1681 W B -0.4334
1682 V B -0.4497
1683 T B 0.0000
1684 D B -0.8541
1685 P B -0.9634
1686 T B -1.4416
1687 P B -2.0472
1688 D B -1.9064
1689 S B -1.0489
1690 L B 0.0000
1691 R B -0.3129
1692 L B 0.0000
1693 S B 0.0000
1694 W B 0.0000
1695 M B -1.0298 mutated: TM1695B
1696 V B 0.0000
1697 P B -1.4555
1698 E B -2.1988
1699 G B -2.0225
1700 Q B -2.2189
1701 F B 0.0000
1702 D B -2.4426
1703 S B -2.1255
1704 F B 0.0000
1705 V B 0.2378
1706 V B 0.0000
1707 Q B -0.2120
1708 F B 0.0000
1709 K B -2.9657
1710 D B -3.3113
1711 K B -3.2388
1712 D B -3.1907
1713 G B -2.4130
1714 P B -1.6288
1715 Q B -0.8485
1716 V B 1.3538
1717 V B 1.0691
1718 P B 0.0544
1719 V B 0.0000
1720 E B -2.7904
1721 G B -2.5492
1722 H B -2.5439
1723 E B -1.9538
1724 R B -1.1976
1725 S B -0.6679
1726 V B -0.2415
1727 T B -0.1243
1728 V B 0.0000
1729 T B -0.5393
1730 P B -0.7535
1731 L B 0.0000
1732 D B -2.0222
1733 A B -2.1707
1734 G B -2.3901
1735 R B -2.5109
1736 K B -3.1198
1737 Y B 0.0000
1738 R B -2.9330
1739 F B 0.0000
1740 L B -0.3793
1741 L B 0.0000
1742 Y B 0.0000
1743 G B 0.0000
1744 L B -1.8649
1745 L B -1.7371
1746 G B -2.0816
1747 K B -2.9174
1748 K B -3.2491
1749 R B -2.9510
1750 H B 0.0000
1751 G B -0.9577
1752 P B -0.5188
1753 L B -0.3103
1754 T B -0.7792
1755 A B -1.0292
1756 D B -1.9360
1757 G B -1.7419
1758 T B -2.0963
1759 T B 0.0000
1760 E B -2.7029
1761 A B -2.1182
1762 R B -2.3623
1763 S B -1.3914
1764 A B -0.7492
1765 M B -0.7025
1766 D B -2.2628
1767 D B -2.5235
1768 T B -1.5542
1769 G B -1.3636
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018