Project name: obj1 [mutate: EF6C, GM9C, WF47C, TY58C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	GM9C,WF47C,EF6C,TY58C
Energy difference between WT (input) and mutated protein (by FoldX)	36.5935 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:26)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:48)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:13)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:14)

• Minimal score value: -3.3654
• Maximal score value: 1.7127
• Average score: -0.5751
• Total score value: -69.0137

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0222
2	V	C	-0.9475
3	Q	C	-1.1239
4	L	C	0.0000
5	V	C	1.2209
6	F	C	0.0000	mutated: EF6C
7	S	C	-0.0157
8	G	C	-0.4084
9	M	C	0.7071	mutated: GM9C
10	G	C	1.2212
11	L	C	1.5554
12	V	C	0.0690
13	Q	C	-1.3371
14	P	C	-1.4887
15	G	C	-1.4134
16	G	C	-0.9785
17	S	C	-1.2309
18	L	C	-0.7875
19	R	C	-1.9897
20	L	C	0.0000
21	S	C	-0.2835
22	C	C	0.0000
23	A	C	0.0460
24	A	C	0.0000
25	S	C	-0.1199
26	D	C	0.0000
27	F	C	1.5446
28	T	C	0.2506
29	F	C	0.0000
30	R	C	-2.0275
31	S	C	-0.8870
32	Y	C	-1.2169
33	E	C	-1.0269
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.2743
40	A	C	-1.0156
41	P	C	-1.2937
42	G	C	-1.4340
43	K	C	-2.1334
44	G	C	-1.0557
45	L	C	0.5060
46	E	C	-0.1664
47	F	C	0.7990	mutated: WF47C
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.2165
53	G	C	-1.2325
54	S	C	-1.2070
55	G	C	-0.7325
56	G	C	-0.4084
57	S	C	0.4274
58	Y	C	1.7028	mutated: TY58C
59	Y	C	1.5540
60	Y	C	0.1578
61	A	C	-0.9705
62	D	C	-2.3091
63	S	C	-1.7134
64	V	C	0.0000
65	K	C	-2.3414
66	G	C	-1.6168
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.4487
70	I	C	0.0000
71	S	C	-0.3394
72	R	C	-1.3505
73	D	C	-1.9739
74	N	C	-2.1845
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6457
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6425
81	L	C	0.0000
82	Q	C	-1.2336
83	M	C	0.0000
84	N	C	-1.3326
85	S	C	-1.2322
86	L	C	0.0000
87	R	C	-2.4721
88	A	C	-1.8894
89	E	C	-2.3444
90	D	C	0.0000
91	T	C	-0.4733
92	A	C	0.0000
93	I	C	1.0479
94	Y	C	0.0000
95	Y	C	0.7782
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.2400
101	D	C	-3.3654
102	G	C	-2.1313
103	F	C	-1.2739
104	N	C	-2.4754
105	K	C	-3.2288
106	G	C	-1.9808
107	F	C	-1.0993
108	D	C	-1.1524
109	Y	C	-0.2419
110	W	C	0.6422
111	G	C	0.1656
112	Q	C	-0.6811
113	G	C	0.2908
114	T	C	0.0000
115	L	C	1.7127
116	V	C	0.0000
117	T	C	0.3885
118	V	C	0.0000
119	S	C	-0.7749
120	S	C	-1.0602