Project name: query_structure

Status: done

Started: 2026-03-16 23:52:09
Settings
Chain sequence(s) A: TKLYCICKTPEDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSSTEDAMTVLTPLTEKDYEGLKRVLRSSLLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKKLKGFKA
P: ARTKQT
input PDB
Selected Chain(s) A,P
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:08)
Show buried residues

Minimal score value
-3.7235
Maximal score value
0.9792
Average score
-1.0268
Total score value
-178.666

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
7 T A -0.9115
8 K A -1.5602
9 L A -0.1255
10 Y A -0.3283
11 C A 0.0000
12 I A 0.7437
13 C A 0.3935
14 K A -1.0513
15 T A -0.9179
16 P A -1.6890
17 E A -3.2111
18 D A -3.2533
19 E A -3.4445
20 S A -2.2432
21 K A -2.4570
22 F A -1.8163
23 Y A 0.0000
24 I A 0.0000
25 G A 0.0000
26 C A 0.0000
27 D A -1.7851
28 R A -1.7429
29 C A -0.9401
30 Q A -1.5606
31 N A -0.6774
32 W A -0.3465
33 Y A 0.0000
34 H A -0.8061
35 G A 0.0000
36 R A -1.6527
37 C A -0.2901
38 V A -0.2362
39 G A -0.6136
40 I A -0.2615
41 L A -0.1102
42 Q A -1.6161
43 S A -1.0880
44 E A -1.2129
45 A A 0.0000
46 E A -1.8083
47 L A -0.1255
48 I A -0.7126
49 D A -2.2890
50 E A -2.3212
51 Y A 0.0000
52 V A -1.1247
53 C A 0.0000
54 P A -0.9584
55 Q A -1.6331
56 C A -1.5871
57 Q A -2.0650
58 S A -1.8525
59 T A -1.6354
60 E A -2.2836
61 D A -2.5375
62 A A -0.8016
63 M A -0.0109
64 T A -0.1967
65 V A 0.4188
66 L A 0.9792
67 T A 0.0597
68 P A -0.8650
69 L A 0.0000
70 T A -2.2094
71 E A -3.1640
72 K A -3.3761
73 D A 0.0000
74 Y A 0.0000
75 E A -3.7235
76 G A -2.6986
77 L A 0.0000
78 K A -3.2704
79 R A -3.4212
80 V A 0.0000
81 L A 0.0000
82 R A -2.8248
83 S A -1.6720
84 L A 0.0000
85 Q A -1.2525
86 A A -0.8064
87 H A -0.8828
88 K A -1.3841
89 M A -0.3033
90 A A 0.0000
91 W A 0.6950
92 P A 0.3489
93 F A 0.0000
94 L A -0.2127
95 E A -1.7002
96 P A -1.2604
97 V A -1.3440
98 D A -2.6998
99 P A -2.2912
100 N A -2.9320
101 D A -3.1272
102 A A -2.2391
103 P A -1.9233
104 D A -1.9447
105 Y A -1.0316
106 Y A -0.8992
107 G A -0.7691
108 V A 0.2627
109 I A 0.0000
110 K A -2.2701
111 E A -2.6117
112 P A -1.5188
113 M A -1.1773
114 D A 0.0000
115 L A 0.0000
116 A A -1.0508
117 T A -1.1833
118 M A 0.0000
119 E A -2.0780
120 E A -2.7816
121 R A -2.0955
122 V A 0.0000
123 Q A -3.3038
124 R A -3.1580
125 R A -2.6993
126 Y A -1.1742
127 Y A 0.0000
128 E A -2.1331
129 K A -1.2938
130 L A 0.0000
131 T A -0.0744
132 E A -0.6042
133 F A 0.0000
134 V A 0.2539
135 A A -0.1979
136 D A 0.0000
137 M A 0.0000
138 T A -0.8618
139 K A -1.6513
140 I A 0.0000
141 F A 0.0000
142 D A -1.7810
143 N A -1.0523
144 C A 0.0000
145 R A -0.4730
146 Y A 0.8873
147 Y A 0.8536
148 N A -0.0666
149 P A -0.7118
150 S A -1.2135
151 D A -2.0279
152 S A -1.0857
153 P A -0.6293
154 F A 0.1933
155 Y A -0.6303
156 Q A -1.1053
157 C A 0.0000
158 A A 0.0000
159 E A -1.1993
160 V A -0.2046
161 L A 0.0000
162 E A -0.6004
163 S A -0.1660
164 F A 0.1726
165 F A 0.0000
166 V A 0.1405
167 Q A -1.4217
168 K A -1.5946
169 L A -0.9312
170 K A -2.1136
171 G A -1.6177
172 F A -0.6901
173 K A -0.7690
174 A A -0.3008
1 A P -1.5239
2 R P -1.5721
3 T P -1.3498
4 K P -2.2523
5 Q P -2.3752
6 T P -1.5700
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018