Project name: 281551cf8809dcb

Chain sequence(s)	A: MMMPANFTAVNSEVVYGGADLFSILADTTAPVWGAANVKKFNTNLITLVSNSFFQKTIDNTLGVMFSGNWGEDNKLFGEEGSLNQKMFGLWTKKADGSLDTRTDDMNFGNKVMQVLGMASVAYTLGTTDAKVGFNDKVAG
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:02)

• Minimal score value: -3.5142
• Maximal score value: 2.907
• Average score: 0.0532
• Total score value: 7.4417

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	1.7904
2	M	A	2.0216
3	M	A	1.5556
4	P	A	0.6033
5	A	A	0.4739
6	N	A	-0.0495
7	F	A	1.5632
8	T	A	0.4226
9	A	A	0.5595
10	V	A	1.6021
11	N	A	0.3419
12	S	A	0.1357
13	E	A	-0.3860
14	V	A	1.6584
15	V	A	2.1310
16	Y	A	1.1760
17	G	A	0.1956
18	G	A	-0.2657
19	A	A	-0.0640
20	D	A	-0.2582
21	L	A	2.0619
22	F	A	2.3391
23	S	A	0.8285
24	I	A	1.2949
25	L	A	1.5505
26	A	A	0.6547
27	D	A	-0.9080
28	T	A	0.1870
29	T	A	0.6511
30	A	A	0.4901
31	P	A	0.4730
32	V	A	1.8214
33	W	A	1.8000
34	G	A	0.3075
35	A	A	-0.1765
36	A	A	-0.7564
37	N	A	-0.8223
38	V	A	-0.4551
39	K	A	-2.1805
40	K	A	-1.9570
41	F	A	0.4901
42	N	A	-0.2329
43	T	A	-0.1343
44	N	A	0.4969
45	L	A	2.2653
46	I	A	2.7307
47	T	A	1.7395
48	L	A	2.5946
49	V	A	2.5666
50	S	A	0.9480
51	N	A	0.2902
52	S	A	0.0209
53	F	A	1.5321
54	F	A	0.9580
55	Q	A	-1.0828
56	K	A	-2.0249
57	T	A	-0.6125
58	I	A	-0.2907
59	D	A	-1.7990
60	N	A	-1.8781
61	T	A	-0.1068
62	L	A	1.2577
63	G	A	0.3418
64	V	A	1.0225
65	M	A	2.2738
66	F	A	2.7795
67	S	A	1.0849
68	G	A	0.0000
69	N	A	-0.9769
70	W	A	0.1905
71	G	A	-1.8958
72	E	A	-3.2466
73	D	A	-3.5142
74	N	A	-3.1150
75	K	A	-2.1154
76	L	A	0.0674
77	F	A	0.8208
78	G	A	-1.1249
79	E	A	-2.6600
80	E	A	-2.8667
81	G	A	0.0000
82	S	A	-0.9833
83	L	A	-0.0668
84	N	A	0.0000
85	Q	A	-1.4013
86	K	A	-1.1391
87	M	A	0.0402
88	F	A	-0.1746
89	G	A	-0.6728
90	L	A	-0.0510
91	W	A	-0.8626
92	T	A	-1.6662
93	K	A	-3.0089
94	K	A	-2.9748
95	A	A	-1.8896
96	D	A	-2.2071
97	G	A	-2.0553
98	S	A	-0.8326
99	L	A	-0.2858
100	D	A	-2.0355
101	T	A	-1.2819
102	R	A	-1.0683
103	T	A	-1.1360
104	D	A	-1.8078
105	D	A	-1.2405
106	M	A	-0.6664
107	N	A	-0.9582
108	F	A	0.9966
109	G	A	-0.0417
110	N	A	-0.5481
111	K	A	0.4545
112	V	A	1.6036
113	M	A	1.7751
114	Q	A	1.0827
115	V	A	2.3542
116	L	A	2.6209
117	G	A	1.8925
118	M	A	2.0594
119	A	A	2.1399
120	S	A	1.9621
121	V	A	2.9070
122	A	A	2.1312
123	Y	A	2.1673
124	T	A	1.4134
125	L	A	1.8403
126	G	A	0.3917
127	T	A	-0.0112
128	T	A	-0.5425
129	D	A	-1.5141
130	A	A	-0.8316
131	K	A	-1.4989
132	V	A	-0.1509
133	G	A	-0.5125
134	F	A	0.3266
135	N	A	-1.1788
136	D	A	-2.0981
137	K	A	-1.5646
138	V	A	0.2081
139	A	A	-0.4191
140	G	A	-0.7527