Project name: 1pga

Chain sequence(s)	A: MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:01)

• Minimal score value: -3.5327
• Maximal score value: 1.1084
• Average score: -1.2837
• Total score value: -71.8898

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.6154
2	T	A	-0.4229
3	Y	A	0.0000
4	K	A	-1.0796
5	L	A	0.0000
6	I	A	-0.6466
7	L	A	0.0000
8	N	A	-2.4369
9	G	A	0.0000
10	K	A	-2.7425
11	T	A	-1.5160
12	L	A	-1.6429
13	K	A	-2.4613
14	G	A	-1.8615
15	E	A	-2.1919
16	T	A	-0.9954
17	T	A	-1.0527
18	T	A	-0.8240
19	E	A	-1.3024
20	A	A	0.0000
21	V	A	1.1084
22	D	A	-0.3982
23	A	A	-0.9290
24	A	A	-0.5102
25	T	A	-0.6669
26	A	A	0.0000
27	E	A	-1.3644
28	K	A	-1.9152
29	V	A	-0.8094
30	F	A	0.0000
31	K	A	-2.3656
32	Q	A	-2.5709
33	Y	A	-1.5553
34	A	A	0.0000
35	N	A	-3.3670
36	D	A	-3.4106
37	N	A	-2.6758
38	G	A	-2.4776
39	V	A	0.0000
40	D	A	-3.5327
41	G	A	-3.0408
42	E	A	-2.5956
43	W	A	-1.0602
44	T	A	-0.5917
45	Y	A	-0.8372
46	D	A	-2.1226
47	D	A	-2.4989
48	A	A	-1.3468
49	T	A	-1.2497
50	K	A	-1.6154
51	T	A	-1.0919
52	F	A	0.0000
53	T	A	-0.5313
54	V	A	0.0000
55	T	A	-2.3587
56	E	A	-2.9474