Project name: 2882ae26f741c8f

Chain sequence(s)	A: KTQTSCPDGYTYDCGAAQQTCCSQYDFCGYPHLSWKDFYCTANYINTYE
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:27)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:27)

• Minimal score value: -2.1944
• Maximal score value: 1.4424
• Average score: -0.6348
• Total score value: -31.1061

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	K	A	-2.1944
2	T	A	-1.5717
3	Q	A	-1.5630
4	T	A	-0.4341
5	S	A	-0.6834
6	C	A	-0.6280
7	P	A	-1.0163
8	D	A	-1.6687
9	G	A	-1.0371
10	Y	A	-0.5924
11	T	A	-0.5069
12	Y	A	-0.2409
13	D	A	-1.3969
14	C	A	-1.1341
15	G	A	-1.1119
16	A	A	-0.9257
17	A	A	-0.7357
18	Q	A	-1.7267
19	Q	A	-1.9865
20	T	A	-1.2675
21	C	A	0.0000
22	C	A	0.0000
23	S	A	-0.1854
24	Q	A	-0.6093
25	Y	A	0.0551
26	D	A	-0.9703
27	F	A	-0.0346
28	C	A	-0.4683
29	G	A	-0.2587
30	Y	A	0.2587
31	P	A	-0.3086
32	H	A	-0.7062
33	L	A	0.0260
34	S	A	0.0423
35	W	A	0.7856
36	K	A	-0.3055
37	D	A	-0.7192
38	F	A	1.4424
39	Y	A	0.8907
40	C	A	0.0000
41	T	A	-0.7168
42	A	A	-1.0570
43	N	A	-1.0844
44	Y	A	-0.5160
45	I	A	-0.0767
46	N	A	-0.8318
47	T	A	-0.7224
48	Y	A	-0.6367
49	E	A	-1.9771