Project name: 28c0e91ad48d2b3

Status: done

Started: 2026-06-22 16:04:32
Settings
Chain sequence(s) B: MEELMKAMEEFKAEKSEFEKLDPVTQMKKLTEVAKKIKEVVEKIKKELEA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:12)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:13)
Show buried residues

Minimal score value
-4.4353
Maximal score value
0.9728
Average score
-2.4363
Total score value
-121.8137

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M B -0.3033
2 E B -2.4085
3 E B -2.9331
4 L B -1.9789
5 M B -1.7452
6 K B -3.5651
7 A B 0.0000
8 M B -2.5170
9 E B -3.9740
10 E B -3.8091
11 F B -3.2413
12 K B -3.7772
13 A B -2.9896
14 E B -3.6257
15 K B -3.7237
16 S B -2.9692
17 E B -3.6960
18 F B 0.0000
19 E B -3.8521
20 K B -3.4173
21 L B -1.9102
22 D B -1.6024
23 P B -0.7655
24 V B 0.9728
25 T B -0.5645
26 Q B -1.6034
27 M B 0.1208
28 K B -1.5355
29 K B -1.9829
30 L B -1.0915
31 T B -1.8157
32 E B -3.1752
33 V B 0.0000
34 A B -2.3082
35 K B -3.6521
36 K B -3.2573
37 I B -2.7337
38 K B -3.9318
39 E B -4.2098
40 V B 0.0000
41 V B -3.0103
42 E B -4.4353
43 K B -4.4112
44 I B -2.9526
45 K B -3.8877
46 K B -4.2531
47 E B -3.4170
48 L B -1.5631
49 E B -2.7140
50 A B -1.5970
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018