Project name: 28c383e7599c540

Status: done

Started: 2026-06-22 16:07:08
Settings
Chain sequence(s) B: MENLMEAKKLLKEMKSELEAAKTPEEVLELYKKLVEVAKKIKELIEKALK
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:18)
Show buried residues

Minimal score value
-3.8871
Maximal score value
0.4692
Average score
-1.6878
Total score value
-84.39

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M B 0.4515
2 E B -1.1592
3 N B -1.3736
4 L B -0.0407
5 M B -0.4802
6 E B -1.7721
7 A B 0.0000
8 K B -2.3760
9 K B -3.2580
10 L B -2.0522
11 L B -1.8910
12 K B -3.8142
13 E B -3.7939
14 M B 0.0000
15 K B -3.2508
16 S B -2.6043
17 E B -2.3835
18 L B -1.9482
19 E B -2.6400
20 A B -1.6694
21 A B -2.0502
22 K B -2.4418
23 T B -1.7512
24 P B -1.5023
25 E B -2.2949
26 E B -2.1905
27 V B -1.0399
28 L B -0.1649
29 E B -2.0414
30 L B 0.0000
31 Y B 0.4692
32 K B -1.3833
33 K B -1.4643
34 L B 0.1164
35 V B 0.1916
36 E B -2.2135
37 V B 0.0000
38 A B -1.6188
39 K B -3.2006
40 K B -3.0797
41 I B -2.4357
42 K B -3.8871
43 E B -3.8767
44 L B 0.0000
45 I B -1.5584
46 E B -2.9942
47 K B -2.7335
48 A B -1.1507
49 L B -0.2735
50 K B -1.7643
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018